Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3743121..3743782 | Replicon | chromosome |
Accession | NZ_CP123003 | ||
Organism | Sinorhizobium meliloti strain BIM B-442D |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q92KY5 |
Locus tag | QC756_RS18180 | Protein ID | WP_010970565.1 |
Coordinates | 3743121..3743525 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q92KY4 |
Locus tag | QC756_RS18185 | Protein ID | WP_010970566.1 |
Coordinates | 3743522..3743782 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC756_RS18165 (QC756_18165) | 3738664..3739776 | + | 1113 | WP_003535893.1 | 3-isopropylmalate dehydrogenase | - |
QC756_RS18170 (QC756_18170) | 3739905..3740612 | + | 708 | WP_010970563.1 | phosphatase PAP2 family protein | - |
QC756_RS18175 (QC756_18175) | 3740713..3742602 | - | 1890 | WP_010970564.1 | MFS transporter | - |
QC756_RS18180 (QC756_18180) | 3743121..3743525 | - | 405 | WP_010970565.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QC756_RS18185 (QC756_18185) | 3743522..3743782 | - | 261 | WP_010970566.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QC756_RS18190 (QC756_18190) | 3743911..3744081 | + | 171 | WP_010970567.1 | hypothetical protein | - |
QC756_RS18195 (QC756_18195) | 3744195..3745229 | + | 1035 | WP_003531790.1 | aspartate-semialdehyde dehydrogenase | - |
QC756_RS18200 (QC756_18200) | 3745402..3746223 | + | 822 | WP_010970568.1 | lytic transglycosylase domain-containing protein | - |
QC756_RS18205 (QC756_18205) | 3746570..3747253 | - | 684 | WP_010970569.1 | carbonic anhydrase | - |
QC756_RS18210 (QC756_18210) | 3747427..3748308 | - | 882 | WP_010970570.1 | pyridoxal kinase PdxY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14507.71 Da Isoelectric Point: 6.7257
>T278339 WP_010970565.1 NZ_CP123003:c3743525-3743121 [Sinorhizobium meliloti]
VISHILDTNAVIALIGRKSDALVTRVLHSPQGIIGLPSVVAYELYFGAQKSAKAQHNLETLRLLMADFPILDFDRNDAFV
AGEIRAALAAKGTPIGPYDVLIAGQAKARGLTLVTNNVGEFNRVENLRVEDWSL
VISHILDTNAVIALIGRKSDALVTRVLHSPQGIIGLPSVVAYELYFGAQKSAKAQHNLETLRLLMADFPILDFDRNDAFV
AGEIRAALAAKGTPIGPYDVLIAGQAKARGLTLVTNNVGEFNRVENLRVEDWSL
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|