Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3101822..3102453 | Replicon | chromosome |
| Accession | NZ_CP123003 | ||
| Organism | Sinorhizobium meliloti strain BIM B-442D | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QC756_RS15300 | Protein ID | WP_010970128.1 |
| Coordinates | 3101822..3102220 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q92MD9 |
| Locus tag | QC756_RS15305 | Protein ID | WP_010970129.1 |
| Coordinates | 3102220..3102453 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC756_RS15265 (QC756_15265) | 3096905..3097207 | - | 303 | WP_010970122.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QC756_RS15270 (QC756_15270) | 3097204..3097479 | - | 276 | WP_010970123.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| QC756_RS15275 (QC756_15275) | 3097764..3097913 | + | 150 | WP_010970124.1 | hypothetical protein | - |
| QC756_RS15280 (QC756_15280) | 3097910..3098845 | + | 936 | WP_010970125.1 | site-specific tyrosine recombinase XerD | - |
| QC756_RS15285 (QC756_15285) | 3098909..3099862 | + | 954 | WP_003527479.1 | acetyl-CoA carboxylase carboxyltransferase subunit alpha | - |
| QC756_RS15290 (QC756_15290) | 3100107..3101549 | + | 1443 | WP_010970126.1 | murein L,D-transpeptidase family protein | - |
| QC756_RS15295 (QC756_15295) | 3101549..3101788 | + | 240 | WP_010970127.1 | sulfurtransferase TusA family protein | - |
| QC756_RS15300 (QC756_15300) | 3101822..3102220 | - | 399 | WP_010970128.1 | type II toxin-antitoxin system toxin VapC | Toxin |
| QC756_RS15305 (QC756_15305) | 3102220..3102453 | - | 234 | WP_010970129.1 | type II toxin-antitoxin system antitoxin VapB | Antitoxin |
| QC756_RS15310 (QC756_15310) | 3102562..3103707 | - | 1146 | WP_280097407.1 | GTP-binding protein | - |
| QC756_RS15315 (QC756_15315) | 3103721..3104803 | - | 1083 | WP_010970131.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
| QC756_RS15320 (QC756_15320) | 3105055..3106218 | + | 1164 | WP_010970132.1 | M20 aminoacylase family protein | - |
| QC756_RS15325 (QC756_15325) | 3106241..3106705 | + | 465 | WP_010970133.1 | Lrp/AsnC ligand binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14859.16 Da Isoelectric Point: 6.6329
>T278338 WP_010970128.1 NZ_CP123003:c3102220-3101822 [Sinorhizobium meliloti]
MLTYMLDTNICIYVMKTYPPAVREKFNGLAEQLCISSITLGELHYGAEKSAWRVENLTAIEHFVARLEVLPFADKAAAHY
GQVRAELERTGTPCGPHDMQIGAHARSEGLIVVTNNIREFVRMPGVRVENWL
MLTYMLDTNICIYVMKTYPPAVREKFNGLAEQLCISSITLGELHYGAEKSAWRVENLTAIEHFVARLEVLPFADKAAAHY
GQVRAELERTGTPCGPHDMQIGAHARSEGLIVVTNNIREFVRMPGVRVENWL
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|