Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 3101822..3102453 Replicon chromosome
Accession NZ_CP123003
Organism Sinorhizobium meliloti strain BIM B-442D

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag QC756_RS15300 Protein ID WP_010970128.1
Coordinates 3101822..3102220 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID Q92MD9
Locus tag QC756_RS15305 Protein ID WP_010970129.1
Coordinates 3102220..3102453 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC756_RS15265 (QC756_15265) 3096905..3097207 - 303 WP_010970122.1 type II toxin-antitoxin system RelE/ParE family toxin -
QC756_RS15270 (QC756_15270) 3097204..3097479 - 276 WP_010970123.1 type II toxin-antitoxin system ParD family antitoxin -
QC756_RS15275 (QC756_15275) 3097764..3097913 + 150 WP_010970124.1 hypothetical protein -
QC756_RS15280 (QC756_15280) 3097910..3098845 + 936 WP_010970125.1 site-specific tyrosine recombinase XerD -
QC756_RS15285 (QC756_15285) 3098909..3099862 + 954 WP_003527479.1 acetyl-CoA carboxylase carboxyltransferase subunit alpha -
QC756_RS15290 (QC756_15290) 3100107..3101549 + 1443 WP_010970126.1 murein L,D-transpeptidase family protein -
QC756_RS15295 (QC756_15295) 3101549..3101788 + 240 WP_010970127.1 sulfurtransferase TusA family protein -
QC756_RS15300 (QC756_15300) 3101822..3102220 - 399 WP_010970128.1 type II toxin-antitoxin system toxin VapC Toxin
QC756_RS15305 (QC756_15305) 3102220..3102453 - 234 WP_010970129.1 type II toxin-antitoxin system antitoxin VapB Antitoxin
QC756_RS15310 (QC756_15310) 3102562..3103707 - 1146 WP_280097407.1 GTP-binding protein -
QC756_RS15315 (QC756_15315) 3103721..3104803 - 1083 WP_010970131.1 D-alanyl-D-alanine carboxypeptidase family protein -
QC756_RS15320 (QC756_15320) 3105055..3106218 + 1164 WP_010970132.1 M20 aminoacylase family protein -
QC756_RS15325 (QC756_15325) 3106241..3106705 + 465 WP_010970133.1 Lrp/AsnC ligand binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-123)

Antitoxin

SpoVT-AbrB domain

(7-56)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14859.16 Da        Isoelectric Point: 6.6329

>T278338 WP_010970128.1 NZ_CP123003:c3102220-3101822 [Sinorhizobium meliloti]
MLTYMLDTNICIYVMKTYPPAVREKFNGLAEQLCISSITLGELHYGAEKSAWRVENLTAIEHFVARLEVLPFADKAAAHY
GQVRAELERTGTPCGPHDMQIGAHARSEGLIVVTNNIREFVRMPGVRVENWL

Download         Length: 399 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8673.87 Da        Isoelectric Point: 8.9167

>AT278338 WP_010970129.1 NZ_CP123003:c3102453-3102220 [Sinorhizobium meliloti]
MASSTVFISNRSQAVRLPKAVAFPEGVHQVDILKIGRSRVIVPQGKRWDDLFLSGPRVSEDFMSERDQPVAETRESF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB Q92MD9

References