Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacT-ataR/DUF1778(antitoxin) |
| Location | 3051914..3052680 | Replicon | chromosome |
| Accession | NZ_CP123003 | ||
| Organism | Sinorhizobium meliloti strain BIM B-442D | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | H0G6D3 |
| Locus tag | QC756_RS15015 | Protein ID | WP_003533488.1 |
| Coordinates | 3052198..3052680 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | - |
| Locus tag | QC756_RS15010 | Protein ID | WP_280097403.1 |
| Coordinates | 3051914..3052198 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC756_RS14995 (QC756_14995) | 3047384..3048772 | + | 1389 | WP_003533497.1 | lipopolysaccharide biosynthesis protein | - |
| QC756_RS15000 (QC756_15000) | 3048776..3050047 | + | 1272 | WP_010970087.1 | GNAT family N-acetyltransferase | - |
| QC756_RS15005 (QC756_15005) | 3050063..3051709 | - | 1647 | WP_010970088.1 | AMP-binding protein | - |
| QC756_RS15010 (QC756_15010) | 3051914..3052198 | + | 285 | WP_280097403.1 | DUF1778 domain-containing protein | Antitoxin |
| QC756_RS15015 (QC756_15015) | 3052198..3052680 | + | 483 | WP_003533488.1 | GNAT family N-acetyltransferase | Toxin |
| QC756_RS15025 (QC756_15025) | 3053145..3053654 | + | 510 | WP_013844819.1 | disulfide bond formation protein B | - |
| QC756_RS15030 (QC756_15030) | 3053686..3054243 | - | 558 | WP_003533486.1 | HNH endonuclease | - |
| QC756_RS15035 (QC756_15035) | 3054349..3054996 | - | 648 | WP_280097404.1 | DNA-3-methyladenine glycosylase | - |
| QC756_RS15040 (QC756_15040) | 3055149..3056045 | + | 897 | WP_010970092.1 | tRNA glutamyl-Q(34) synthetase GluQRS | - |
| QC756_RS15045 (QC756_15045) | 3056064..3056939 | - | 876 | WP_010970093.1 | YihY/virulence factor BrkB family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17463.88 Da Isoelectric Point: 7.3827
>T278337 WP_003533488.1 NZ_CP123003:3052198-3052680 [Sinorhizobium meliloti]
MLSAPTPLGEAHDFDLFQSGNDTLDDWLRRRAHANQASGASRTYVIAEEWRVVGYYCLASGALDLADAPSSVRRNMPDPI
PMAVLGRLAIDRDWQGKGLGAALLQDAVLRSSQAADIMGIRGLLVHAISGEAKAFYEHYGFQCSPNHPMTLVLSLKGKRR
MLSAPTPLGEAHDFDLFQSGNDTLDDWLRRRAHANQASGASRTYVIAEEWRVVGYYCLASGALDLADAPSSVRRNMPDPI
PMAVLGRLAIDRDWQGKGLGAALLQDAVLRSSQAADIMGIRGLLVHAISGEAKAFYEHYGFQCSPNHPMTLVLSLKGKRR
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|