Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 2299205..2299859 | Replicon | chromosome |
| Accession | NZ_CP123003 | ||
| Organism | Sinorhizobium meliloti strain BIM B-442D | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | H0G1A3 |
| Locus tag | QC756_RS11290 | Protein ID | WP_003530010.1 |
| Coordinates | 2299205..2299393 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q92NX0 |
| Locus tag | QC756_RS11295 | Protein ID | WP_010969659.1 |
| Coordinates | 2299398..2299859 (+) | Length | 154 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC756_RS11275 (QC756_11275) | 2295771..2297081 | + | 1311 | WP_010969656.1 | HlyD family type I secretion periplasmic adaptor subunit | - |
| QC756_RS11280 (QC756_11280) | 2297106..2298077 | - | 972 | WP_017265202.1 | glycosyltransferase family 2 protein | - |
| QC756_RS11285 (QC756_11285) | 2298258..2299028 | - | 771 | WP_010969658.1 | Stf0 family sulphotransferase | - |
| QC756_RS11290 (QC756_11290) | 2299205..2299393 | + | 189 | WP_003530010.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QC756_RS11295 (QC756_11295) | 2299398..2299859 | + | 462 | WP_010969659.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QC756_RS11300 (QC756_11300) | 2300464..2300643 | - | 180 | WP_026029858.1 | hypothetical protein | - |
| QC756_RS11305 (QC756_11305) | 2300722..2301777 | + | 1056 | WP_017275254.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
| QC756_RS11310 (QC756_11310) | 2302004..2302428 | - | 425 | Protein_2218 | ATP-dependent DNA ligase | - |
| QC756_RS11315 (QC756_11315) | 2302521..2302691 | + | 171 | WP_164830110.1 | hypothetical protein | - |
| QC756_RS11320 (QC756_11320) | 2303196..2303369 | - | 174 | WP_017266546.1 | DUF3606 domain-containing protein | - |
| QC756_RS11325 (QC756_11325) | 2304189..2304392 | - | 204 | WP_026029857.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2293097..2354554 | 61457 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 6971.15 Da Isoelectric Point: 11.0889
>T278335 WP_003530010.1 NZ_CP123003:2299205-2299393 [Sinorhizobium meliloti]
MKSGDIIAALQKDGWYEVATKGSHVQFKHPKKHGRVTVPHPKRDLPIGTLRSIEKQSGLKLR
MKSGDIIAALQKDGWYEVATKGSHVQFKHPKKHGRVTVPHPKRDLPIGTLRSIEKQSGLKLR
Download Length: 189 bp
Antitoxin
Download Length: 154 a.a. Molecular weight: 16293.17 Da Isoelectric Point: 4.3990
>AT278335 WP_010969659.1 NZ_CP123003:2299398-2299859 [Sinorhizobium meliloti]
MRNYIGLIHKDAESDYGVSFPDFSGVVTAGADLDDARAMAEEALALHIEGLVEDGEAIPEPSSLEVVMSDAENRDCVAIL
VAVKTEAKRAIRVNVTLPEGVLKQIDAFAEAHGLTRSGFLARAATHEIERANDGHDAYAESRLSALGTSSKNV
MRNYIGLIHKDAESDYGVSFPDFSGVVTAGADLDDARAMAEEALALHIEGLVEDGEAIPEPSSLEVVMSDAENRDCVAIL
VAVKTEAKRAIRVNVTLPEGVLKQIDAFAEAHGLTRSGFLARAATHEIERANDGHDAYAESRLSALGTSSKNV
Download Length: 462 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|