Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-RHH |
| Location | 1437125..1437699 | Replicon | chromosome |
| Accession | NZ_CP123003 | ||
| Organism | Sinorhizobium meliloti strain BIM B-442D | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q92QN4 |
| Locus tag | QC756_RS06990 | Protein ID | WP_010969154.1 |
| Coordinates | 1437125..1437490 (-) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q92QN3 |
| Locus tag | QC756_RS06995 | Protein ID | WP_010969155.1 |
| Coordinates | 1437484..1437699 (-) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC756_RS06965 (QC756_06965) | 1432265..1433707 | + | 1443 | WP_010969150.1 | NADH-quinone oxidoreductase subunit NuoN | - |
| QC756_RS06970 (QC756_06970) | 1433704..1434471 | + | 768 | WP_003531861.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| QC756_RS06975 (QC756_06975) | 1434499..1436166 | + | 1668 | WP_010969151.1 | ribonuclease J | - |
| QC756_RS06980 (QC756_06980) | 1436225..1436629 | + | 405 | WP_010969152.1 | methylmalonyl-CoA epimerase | - |
| QC756_RS06985 (QC756_06985) | 1436769..1437038 | + | 270 | WP_014526683.1 | DUF1467 family protein | - |
| QC756_RS06990 (QC756_06990) | 1437125..1437490 | - | 366 | WP_010969154.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QC756_RS06995 (QC756_06995) | 1437484..1437699 | - | 216 | WP_010969155.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| QC756_RS07000 (QC756_07000) | 1437767..1437994 | - | 228 | WP_017264047.1 | hypothetical protein | - |
| QC756_RS07005 (QC756_07005) | 1438410..1439738 | + | 1329 | WP_003531873.1 | proline--tRNA ligase | - |
| QC756_RS07010 (QC756_07010) | 1439759..1441069 | + | 1311 | WP_014529722.1 | lipoprotein-releasing ABC transporter permease subunit | - |
| QC756_RS07015 (QC756_07015) | 1441087..1441773 | + | 687 | WP_010969157.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13592.57 Da Isoelectric Point: 5.1787
>T278334 WP_010969154.1 NZ_CP123003:c1437490-1437125 [Sinorhizobium meliloti]
MVGALFDTNILIDHLNAVPQAHKELDRFENRAISIITWMEVMVGADAELVEPTRRFLDGFETIALNDEIANRAVTLRRAH
RIKLPDAVIWATAQTAGRLLVTRNTKDFPADDPGIREPYAV
MVGALFDTNILIDHLNAVPQAHKELDRFENRAISIITWMEVMVGADAELVEPTRRFLDGFETIALNDEIANRAVTLRRAH
RIKLPDAVIWATAQTAGRLLVTRNTKDFPADDPGIREPYAV
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|