Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 871025..871665 | Replicon | chromosome |
Accession | NZ_CP123003 | ||
Organism | Sinorhizobium meliloti strain BIM B-442D |
Toxin (Protein)
Gene name | vapC | Uniprot ID | H0G6N1 |
Locus tag | QC756_RS04135 | Protein ID | WP_003533691.1 |
Coordinates | 871025..871411 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | H0G6N0 |
Locus tag | QC756_RS04140 | Protein ID | WP_003533689.1 |
Coordinates | 871411..871665 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QC756_RS04110 (QC756_04110) | 866489..866968 | + | 480 | WP_003537307.1 | GNAT family N-acetyltransferase | - |
QC756_RS04115 (QC756_04115) | 867012..867461 | - | 450 | WP_003537305.1 | nucleoside deaminase | - |
QC756_RS04120 (QC756_04120) | 867536..869257 | + | 1722 | WP_010968830.1 | pseudouridine synthase | - |
QC756_RS04125 (QC756_04125) | 869264..869824 | + | 561 | WP_010968831.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
QC756_RS04130 (QC756_04130) | 869897..870796 | + | 900 | WP_010968832.1 | patatin-like phospholipase family protein | - |
QC756_RS04135 (QC756_04135) | 871025..871411 | - | 387 | WP_003533691.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QC756_RS04140 (QC756_04140) | 871411..871665 | - | 255 | WP_003533689.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QC756_RS04145 (QC756_04145) | 871804..873636 | - | 1833 | WP_010968833.1 | monovalent cation:proton antiporter-2 (CPA2) family protein | - |
QC756_RS04150 (QC756_04150) | 873788..875134 | + | 1347 | WP_010968834.1 | TldD/PmbA family protein | - |
QC756_RS04155 (QC756_04155) | 875243..876061 | + | 819 | WP_010968835.1 | 3'(2'),5'-bisphosphate nucleotidase CysQ | - |
QC756_RS04160 (QC756_04160) | 876122..876358 | + | 237 | WP_003533684.1 | DUF4170 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 13904.77 Da Isoelectric Point: 4.5716
>T278332 WP_003533691.1 NZ_CP123003:c871411-871025 [Sinorhizobium meliloti]
MVIDTSAIAAIAFNEQEAGSFREKIADDPVRLISAATALEAAMVIETRLGEAAGAELDLWLYKANVEIVAVTAEHMDQAR
RAWRRFGKGRHPAGLNFGDCFSYALAFLTNEPLLFKGSDFSQTDIPAA
MVIDTSAIAAIAFNEQEAGSFREKIADDPVRLISAATALEAAMVIETRLGEAAGAELDLWLYKANVEIVAVTAEHMDQAR
RAWRRFGKGRHPAGLNFGDCFSYALAFLTNEPLLFKGSDFSQTDIPAA
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|