Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 296234..296835 | Replicon | plasmid unnamed2 |
Accession | NZ_CP123002 | ||
Organism | Neorhizobium petrolearium strain OS53 |
Toxin (Protein)
Gene name | tad | Uniprot ID | - |
Locus tag | QEO92_RS32690 | Protein ID | WP_210058829.1 |
Coordinates | 296234..296557 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | - |
Locus tag | QEO92_RS32695 | Protein ID | WP_210058830.1 |
Coordinates | 296554..296835 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEO92_RS32660 (QEO92_32660) | 292192..292794 | - | 603 | Protein_306 | IS21 family transposase | - |
QEO92_RS32665 (QEO92_32665) | 293121..294473 | + | 1353 | WP_210058824.1 | ISAs1 family transposase | - |
QEO92_RS32670 (QEO92_32670) | 294556..294714 | - | 159 | Protein_308 | HU family DNA-binding protein | - |
QEO92_RS32675 (QEO92_32675) | 294852..294980 | - | 129 | Protein_309 | WGR domain-containing protein | - |
QEO92_RS32680 (QEO92_32680) | 295250..295498 | + | 249 | WP_210058827.1 | helix-turn-helix transcriptional regulator | - |
QEO92_RS32685 (QEO92_32685) | 295528..295842 | - | 315 | WP_210058828.1 | hypothetical protein | - |
QEO92_RS32690 (QEO92_32690) | 296234..296557 | + | 324 | WP_210058829.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QEO92_RS32695 (QEO92_32695) | 296554..296835 | + | 282 | WP_210058830.1 | XRE family transcriptional regulator | Antitoxin |
QEO92_RS32700 (QEO92_32700) | 296943..297437 | - | 495 | WP_210058831.1 | hypothetical protein | - |
QEO92_RS32705 (QEO92_32705) | 297516..298172 | - | 657 | WP_210058832.1 | GNAT family N-acetyltransferase | - |
QEO92_RS32710 (QEO92_32710) | 298332..298622 | - | 291 | WP_210058833.1 | DUF2285 domain-containing protein | - |
QEO92_RS32715 (QEO92_32715) | 299216..301213 | + | 1998 | WP_210058834.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | htpB | 1..379813 | 379813 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12243.01 Da Isoelectric Point: 10.1375
>T278330 WP_210058829.1 NZ_CP123002:296234-296557 [Neorhizobium petrolearium]
MKAIEWLGSSRADVRSFPDDARVEAGWQLELVQRGDDPDDWKPMQAVGPGVREIRIREASGAFRVIYLATVEDRVLVLHA
FQKKTQAPSKKDLDLAAQRLKRWKAER
MKAIEWLGSSRADVRSFPDDARVEAGWQLELVQRGDDPDDWKPMQAVGPGVREIRIREASGAFRVIYLATVEDRVLVLHA
FQKKTQAPSKKDLDLAAQRLKRWKAER
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|