Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 416340..416875 | Replicon | plasmid unnamed1 |
Accession | NZ_CP123001 | ||
Organism | Neorhizobium petrolearium strain OS53 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A095WNQ3 |
Locus tag | QEO92_RS28825 | Protein ID | WP_037148910.1 |
Coordinates | 416585..416875 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A095VFW5 |
Locus tag | QEO92_RS28820 | Protein ID | WP_037148912.1 |
Coordinates | 416340..416588 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEO92_RS28805 (QEO92_28805) | 411482..412186 | - | 705 | WP_227705579.1 | IS6 family transposase | - |
QEO92_RS28810 (QEO92_28810) | 412307..415450 | - | 3144 | WP_227705580.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
QEO92_RS28815 (QEO92_28815) | 415562..416137 | + | 576 | Protein_392 | IS5 family transposase | - |
QEO92_RS28820 (QEO92_28820) | 416340..416588 | + | 249 | WP_037148912.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
QEO92_RS28825 (QEO92_28825) | 416585..416875 | + | 291 | WP_037148910.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QEO92_RS28830 (QEO92_28830) | 417439..419796 | - | 2358 | WP_227705886.1 | hypothetical protein | - |
QEO92_RS28835 (QEO92_28835) | 420041..421222 | + | 1182 | WP_227705581.1 | Fic family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..916660 | 916660 | |
- | flank | IS/Tn | - | - | 411482..412186 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11083.59 Da Isoelectric Point: 9.5945
>T278327 WP_037148910.1 NZ_CP123001:416585-416875 [Neorhizobium petrolearium]
MTGFILSPAAQADVERIWDYTATRWNVDQAERYIQNIRDACRALAAGTRVSRPVDIREGYRKVSVGSHFIYFKSNDTGQI
VVIRILHQRMDVDNRL
MTGFILSPAAQADVERIWDYTATRWNVDQAERYIQNIRDACRALAAGTRVSRPVDIREGYRKVSVGSHFIYFKSNDTGQI
VVIRILHQRMDVDNRL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A095WNQ3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A095VFW5 |