Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 306963..307753 | Replicon | plasmid unnamed1 |
Accession | NZ_CP123001 | ||
Organism | Neorhizobium petrolearium strain OS53 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | QEO92_RS28365 | Protein ID | WP_227705509.1 |
Coordinates | 307256..307753 (+) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | QEO92_RS28360 | Protein ID | WP_227705508.1 |
Coordinates | 306963..307259 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEO92_RS28335 (QEO92_28335) | 302898..303623 | - | 726 | WP_227705503.1 | SDR family oxidoreductase | - |
QEO92_RS28340 (QEO92_28340) | 303878..304780 | + | 903 | WP_227705504.1 | LysR family transcriptional regulator | - |
QEO92_RS28345 (QEO92_28345) | 305185..305628 | - | 444 | WP_227705505.1 | hypothetical protein | - |
QEO92_RS28350 (QEO92_28350) | 305732..306487 | - | 756 | WP_227705506.1 | hypothetical protein | - |
QEO92_RS28355 (QEO92_28355) | 306462..306683 | + | 222 | WP_227705507.1 | hypothetical protein | - |
QEO92_RS28360 (QEO92_28360) | 306963..307259 | + | 297 | WP_227705508.1 | DUF1778 domain-containing protein | Antitoxin |
QEO92_RS28365 (QEO92_28365) | 307256..307753 | + | 498 | WP_227705509.1 | GNAT family N-acetyltransferase | Toxin |
QEO92_RS28370 (QEO92_28370) | 307904..308950 | - | 1047 | WP_227705510.1 | LacI family DNA-binding transcriptional regulator | - |
QEO92_RS28375 (QEO92_28375) | 309100..310047 | + | 948 | WP_227705511.1 | dihydrodipicolinate synthase family protein | - |
QEO92_RS28380 (QEO92_28380) | 310303..311487 | + | 1185 | WP_280107549.1 | Nramp family divalent metal transporter | - |
QEO92_RS28385 (QEO92_28385) | 311776..312672 | - | 897 | WP_227705513.1 | LysR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..916660 | 916660 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17806.31 Da Isoelectric Point: 6.8723
>T278326 WP_227705509.1 NZ_CP123001:307256-307753 [Neorhizobium petrolearium]
VTLSAPAPLAEHHELAEFNSGVAELDDWLRRRARSNQASGASRTFVVCDESRVIAYYALASGAVKQPEAPGRFRRNMPDP
IPVAVLGRLAIDQSYQGRGIGRALVRDAGLRLLNAAEVLGIRGMLVHAISDDARAFYEAVGFLSSPSDPMMLMVGLHDLN
NALNP
VTLSAPAPLAEHHELAEFNSGVAELDDWLRRRARSNQASGASRTFVVCDESRVIAYYALASGAVKQPEAPGRFRRNMPDP
IPVAVLGRLAIDQSYQGRGIGRALVRDAGLRLLNAAEVLGIRGMLVHAISDDARAFYEAVGFLSSPSDPMMLMVGLHDLN
NALNP
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|