Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 2998513..2999183 | Replicon | chromosome |
Accession | NZ_CP123000 | ||
Organism | Neorhizobium petrolearium strain OS53 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A095VGK5 |
Locus tag | QEO92_RS14885 | Protein ID | WP_037149593.1 |
Coordinates | 2998513..2998932 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A0M3AZ99 |
Locus tag | QEO92_RS14890 | Protein ID | WP_037149590.1 |
Coordinates | 2998929..2999183 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEO92_RS14860 (QEO92_14860) | 2994636..2994947 | - | 312 | WP_227703555.1 | helix-turn-helix domain-containing protein | - |
QEO92_RS14865 (QEO92_14865) | 2995202..2995928 | + | 727 | Protein_2937 | hypothetical protein | - |
QEO92_RS14870 (QEO92_14870) | 2995973..2997484 | - | 1512 | WP_227703556.1 | hypothetical protein | - |
QEO92_RS14875 (QEO92_14875) | 2997716..2998117 | - | 402 | WP_227703557.1 | tRNA(fMet)-specific endonuclease VapC | - |
QEO92_RS14880 (QEO92_14880) | 2998117..2998347 | - | 231 | WP_037149595.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
QEO92_RS14885 (QEO92_14885) | 2998513..2998932 | - | 420 | WP_037149593.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QEO92_RS14890 (QEO92_14890) | 2998929..2999183 | - | 255 | WP_037149590.1 | plasmid stabilization protein | Antitoxin |
QEO92_RS14895 (QEO92_14895) | 2999664..2999918 | - | 255 | WP_227705173.1 | type II toxin-antitoxin system VapC family toxin | - |
QEO92_RS14900 (QEO92_14900) | 2999958..3000210 | - | 253 | Protein_2944 | IS110 family transposase | - |
QEO92_RS14905 (QEO92_14905) | 3000416..3001945 | - | 1530 | WP_227703558.1 | ABC transporter substrate-binding protein | - |
QEO92_RS14910 (QEO92_14910) | 3001973..3002800 | - | 828 | WP_227703559.1 | ABC transporter permease | - |
QEO92_RS14915 (QEO92_14915) | 3002797..3003768 | - | 972 | WP_227703560.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14945.21 Da Isoelectric Point: 4.8231
>T278325 WP_037149593.1 NZ_CP123000:c2998932-2998513 [Neorhizobium petrolearium]
MILLDTNVISEPWKPVPDAAVIDWLDAQAIETLFLSAITIAELRFGIAAMPSGRRQTILRDRLEGEVLPHFSERILPFDL
ATSQFYSELMACARVSGKAIGTADGYIAASAAANGLAVATRDTSPFAAAGLKVINPWSR
MILLDTNVISEPWKPVPDAAVIDWLDAQAIETLFLSAITIAELRFGIAAMPSGRRQTILRDRLEGEVLPHFSERILPFDL
ATSQFYSELMACARVSGKAIGTADGYIAASAAANGLAVATRDTSPFAAAGLKVINPWSR
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A095VGK5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M3AZ99 |