Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 2991759..2992333 | Replicon | chromosome |
| Accession | NZ_CP123000 | ||
| Organism | Neorhizobium petrolearium strain OS53 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A095XL15 |
| Locus tag | QEO92_RS14840 | Protein ID | WP_037149607.1 |
| Coordinates | 2991759..2992112 (-) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A095VFV3 |
| Locus tag | QEO92_RS14845 | Protein ID | WP_037149604.1 |
| Coordinates | 2992109..2992333 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEO92_RS14820 (QEO92_14820) | 2987375..2988715 | + | 1341 | WP_227703553.1 | ATP-binding protein | - |
| QEO92_RS14825 (QEO92_14825) | 2988832..2989371 | + | 540 | WP_227703554.1 | hypothetical protein | - |
| QEO92_RS14830 (QEO92_14830) | 2989541..2989783 | + | 243 | WP_037155660.1 | cysteine rich repeat-containing protein | - |
| QEO92_RS14835 (QEO92_14835) | 2990424..2991710 | + | 1287 | Protein_2931 | IS21 family transposase | - |
| QEO92_RS14840 (QEO92_14840) | 2991759..2992112 | - | 354 | WP_037149607.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QEO92_RS14845 (QEO92_14845) | 2992109..2992333 | - | 225 | WP_037149604.1 | antitoxin MazE family protein | Antitoxin |
| QEO92_RS14850 (QEO92_14850) | 2992654..2992869 | - | 216 | WP_037149602.1 | AlpA family phage regulatory protein | - |
| QEO92_RS14855 (QEO92_14855) | 2993390..2994643 | - | 1254 | WP_037149788.1 | HipA domain-containing protein | - |
| QEO92_RS14860 (QEO92_14860) | 2994636..2994947 | - | 312 | WP_227703555.1 | helix-turn-helix domain-containing protein | - |
| QEO92_RS14865 (QEO92_14865) | 2995202..2995928 | + | 727 | Protein_2937 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2990436..2991737 | 1301 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 12833.72 Da Isoelectric Point: 5.2033
>T278323 WP_037149607.1 NZ_CP123000:c2992112-2991759 [Neorhizobium petrolearium]
MRRGDIWTVAGGKDYAGKPRPVVIMQDDSFDGTDSITVCAFTSDDTEAPLFRLPVAPDERNGLRLSSRLMVDKITTVPKS
KIGEKVGRLDDEDIVRLNQAMLVFLGLAVSPRVRGEA
MRRGDIWTVAGGKDYAGKPRPVVIMQDDSFDGTDSITVCAFTSDDTEAPLFRLPVAPDERNGLRLSSRLMVDKITTVPKS
KIGEKVGRLDDEDIVRLNQAMLVFLGLAVSPRVRGEA
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A095XL15 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A095VFV3 |