Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2826722..2827512 | Replicon | chromosome |
Accession | NZ_CP123000 | ||
Organism | Neorhizobium petrolearium strain OS53 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | QEO92_RS14100 | Protein ID | WP_227703476.1 |
Coordinates | 2826722..2827219 (-) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A095VJJ4 |
Locus tag | QEO92_RS14105 | Protein ID | WP_037146495.1 |
Coordinates | 2827216..2827512 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEO92_RS14090 (QEO92_14090) | 2823322..2823978 | + | 657 | WP_052182652.1 | TetR/AcrR family transcriptional regulator | - |
QEO92_RS14095 (QEO92_14095) | 2824474..2826366 | + | 1893 | WP_227703475.1 | PhoX family phosphatase | - |
QEO92_RS14100 (QEO92_14100) | 2826722..2827219 | - | 498 | WP_227703476.1 | GNAT family N-acetyltransferase | Toxin |
QEO92_RS14105 (QEO92_14105) | 2827216..2827512 | - | 297 | WP_037146495.1 | DUF1778 domain-containing protein | Antitoxin |
QEO92_RS14110 (QEO92_14110) | 2828125..2829663 | - | 1539 | WP_037146497.1 | Fic family protein | - |
QEO92_RS14115 (QEO92_14115) | 2829675..2829935 | + | 261 | WP_152601039.1 | hypothetical protein | - |
QEO92_RS14120 (QEO92_14120) | 2830051..2831025 | - | 975 | WP_037146498.1 | AraC family transcriptional regulator | - |
QEO92_RS14125 (QEO92_14125) | 2831196..2831555 | + | 360 | WP_037146500.1 | c-type cytochrome | - |
QEO92_RS14130 (QEO92_14130) | 2831573..2832025 | + | 453 | WP_037146502.1 | (2Fe-2S)-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17609.10 Da Isoelectric Point: 6.8718
>T278322 WP_227703476.1 NZ_CP123000:c2827219-2826722 [Neorhizobium petrolearium]
VTLSAPAPLADHHELADFNSGVPELDDWLRRRARANQAGGASRTFVVCEGIGVIAYYALASGAVKQPEAPGRFRRNMPDP
IPVAVLGRLAIDQSYQGRGIGRALVRDAGLRLRNAAEVLGIRGVLVHAISDDARAFYEAVGFLPSPSDPMMLMVGLHDLN
DALNG
VTLSAPAPLADHHELADFNSGVPELDDWLRRRARANQAGGASRTFVVCEGIGVIAYYALASGAVKQPEAPGRFRRNMPDP
IPVAVLGRLAIDQSYQGRGIGRALVRDAGLRLRNAAEVLGIRGVLVHAISDDARAFYEAVGFLPSPSDPMMLMVGLHDLN
DALNG
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|