Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbE-relB/ParE-YafN |
| Location | 1636783..1637302 | Replicon | chromosome |
| Accession | NZ_CP123000 | ||
| Organism | Neorhizobium petrolearium strain OS53 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | - |
| Locus tag | QEO92_RS08435 | Protein ID | WP_227702706.1 |
| Coordinates | 1637021..1637302 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QEO92_RS08430 | Protein ID | WP_227702705.1 |
| Coordinates | 1636783..1637031 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEO92_RS08410 (QEO92_08410) | 1632378..1633142 | + | 765 | WP_227702701.1 | DUF1028 domain-containing protein | - |
| QEO92_RS08415 (QEO92_08415) | 1633139..1634950 | + | 1812 | WP_227702702.1 | ABC transporter ATP-binding protein | - |
| QEO92_RS08420 (QEO92_08420) | 1634962..1635765 | - | 804 | WP_227702703.1 | DNA repair protein RadC | - |
| QEO92_RS08425 (QEO92_08425) | 1635768..1636604 | - | 837 | WP_227702704.1 | type I methionyl aminopeptidase | - |
| QEO92_RS08430 (QEO92_08430) | 1636783..1637031 | + | 249 | WP_227702705.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QEO92_RS08435 (QEO92_08435) | 1637021..1637302 | + | 282 | WP_227702706.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QEO92_RS08440 (QEO92_08440) | 1637299..1638006 | - | 708 | WP_227702707.1 | DNA/RNA nuclease SfsA | - |
| QEO92_RS08445 (QEO92_08445) | 1638019..1639866 | - | 1848 | WP_227702708.1 | class I poly(R)-hydroxyalkanoic acid synthase | - |
| QEO92_RS08450 (QEO92_08450) | 1639991..1640392 | + | 402 | WP_227702709.1 | hypothetical protein | - |
| QEO92_RS08455 (QEO92_08455) | 1640498..1641715 | + | 1218 | WP_037155344.1 | LL-diaminopimelate aminotransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10940.76 Da Isoelectric Point: 10.7023
>T278319 WP_227702706.1 NZ_CP123000:1637021-1637302 [Neorhizobium petrolearium]
MSYELAFLDVALKEWRKLDANIRDQFRKKLAERLENPRVPSAQLYGAKDRYKVKLRSAGYRLVYEVRDAQLIVLVIAVGR
RDRNAVYKAAEKR
MSYELAFLDVALKEWRKLDANIRDQFRKKLAERLENPRVPSAQLYGAKDRYKVKLRSAGYRLVYEVRDAQLIVLVIAVGR
RDRNAVYKAAEKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|