Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 504852..505390 | Replicon | chromosome |
Accession | NZ_CP123000 | ||
Organism | Neorhizobium petrolearium strain OS53 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QEO92_RS02580 | Protein ID | WP_227702056.1 |
Coordinates | 505067..505390 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | QEO92_RS02575 | Protein ID | WP_081953014.1 |
Coordinates | 504852..505067 (+) | Length | 72 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEO92_RS02550 (QEO92_02550) | 500072..500689 | - | 618 | WP_227702052.1 | hypothetical protein | - |
QEO92_RS02555 (QEO92_02555) | 501162..502409 | + | 1248 | WP_227702053.1 | aromatic ring-hydroxylating dioxygenase subunit alpha | - |
QEO92_RS02560 (QEO92_02560) | 502529..502960 | + | 432 | WP_227702054.1 | BA14K family protein | - |
QEO92_RS02565 (QEO92_02565) | 503152..503643 | + | 492 | WP_227702055.1 | BA14K family protein | - |
QEO92_RS02570 (QEO92_02570) | 503713..504708 | - | 996 | WP_037159853.1 | transporter | - |
QEO92_RS02575 (QEO92_02575) | 504852..505067 | + | 216 | WP_081953014.1 | antitoxin MazE family protein | Antitoxin |
QEO92_RS02580 (QEO92_02580) | 505067..505390 | + | 324 | WP_227702056.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QEO92_RS02585 (QEO92_02585) | 505476..507281 | + | 1806 | WP_227702057.1 | acyl-CoA dehydrogenase | - |
QEO92_RS02590 (QEO92_02590) | 507347..508054 | + | 708 | WP_280107517.1 | crotonase/enoyl-CoA hydratase family protein | - |
QEO92_RS02595 (QEO92_02595) | 508140..508442 | + | 303 | WP_227702059.1 | hypothetical protein | - |
QEO92_RS02600 (QEO92_02600) | 508443..509687 | - | 1245 | WP_227702060.1 | class I SAM-dependent RNA methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11711.62 Da Isoelectric Point: 6.2790
>T278317 WP_227702056.1 NZ_CP123000:505067-505390 [Neorhizobium petrolearium]
MQRGDLVTVALTGDFGKPRPALIVQSDLFDETDTLTVLLLSSTLVNAPLVRLTVQPDATNALNKPSQIMVDKTMTVRRDK
LGKVFGRIDDETMISVTRSLAVFFGFA
MQRGDLVTVALTGDFGKPRPALIVQSDLFDETDTLTVLLLSSTLVNAPLVRLTVQPDATNALNKPSQIMVDKTMTVRRDK
LGKVFGRIDDETMISVTRSLAVFFGFA
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|