Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 412199..412682 Replicon chromosome
Accession NZ_CP123000
Organism Neorhizobium petrolearium strain OS53

Toxin (Protein)


Gene name pasB Uniprot ID A0A095WGQ5
Locus tag QEO92_RS02150 Protein ID WP_037158430.1
Coordinates 412199..412468 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID A0A095UB52
Locus tag QEO92_RS02155 Protein ID WP_037158427.1
Coordinates 412452..412682 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEO92_RS02115 (QEO92_02115) 407324..408016 - 693 WP_227701998.1 L,D-transpeptidase -
QEO92_RS02120 (QEO92_02120) 408163..408918 - 756 WP_037159886.1 L,D-transpeptidase -
QEO92_RS02125 (QEO92_02125) 409140..409769 + 630 WP_227701999.1 DNA-3-methyladenine glycosylase I -
QEO92_RS02130 (QEO92_02130) 409756..410460 - 705 WP_037158442.1 HAD family hydrolase -
QEO92_RS02135 (QEO92_02135) 410550..410936 - 387 WP_227702000.1 DUF305 domain-containing protein -
QEO92_RS02140 (QEO92_02140) 410993..411382 - 390 WP_152601288.1 hypothetical protein -
QEO92_RS02145 (QEO92_02145) 411434..412195 - 762 WP_037158433.1 hypothetical protein -
QEO92_RS02150 (QEO92_02150) 412199..412468 - 270 WP_037158430.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QEO92_RS02155 (QEO92_02155) 412452..412682 - 231 WP_037158427.1 DUF6290 family protein Antitoxin
QEO92_RS02160 (QEO92_02160) 412824..414422 + 1599 WP_227702001.1 histidine--tRNA ligase -
QEO92_RS02165 (QEO92_02165) 414627..415811 + 1185 WP_227702002.1 ATP phosphoribosyltransferase regulatory subunit -
QEO92_RS02170 (QEO92_02170) 415808..416506 + 699 WP_227702003.1 ATP phosphoribosyltransferase -
QEO92_RS02175 (QEO92_02175) 416530..416934 + 405 WP_037158415.1 GFA family protein -
QEO92_RS02180 (QEO92_02180) 416998..417453 - 456 WP_227702004.1 DoxX family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-88)

Antitoxin

Protein of unknown function DUF6290

(5-72)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10500.11 Da        Isoelectric Point: 9.5697

>T278316 WP_037158430.1 NZ_CP123000:c412468-412199 [Neorhizobium petrolearium]
MAWTIELRDSARKQLKHLAHHDAARIISFLEERVATHENPRELGAALKGHVLGGYWRYRVGDYRIICEIQDQRLVVLVIE
IGHRREVYR

Download         Length: 270 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8801.87 Da        Isoelectric Point: 4.2245

>AT278316 WP_037158427.1 NZ_CP123000:c412682-412452 [Neorhizobium petrolearium]
MNKRVTIEMPDEMHKLIAEYAAEAGAEPDTYMRDVLEQHLEDLHDIALAEAAMERIRNGERTYTLEEVKRELGLDD

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A095WGQ5

Antitoxin

Source ID Structure
AlphaFold DB A0A095UB52

References