Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Rv0298-Rv0299/-
Location 84189..84715 Replicon plasmid unnamed5
Accession NZ_CP122997
Organism Mycolicibacterium aubagnense strain HPB1.1

Toxin (Protein)


Gene name Rv0299 Uniprot ID -
Locus tag QDT91_RS29655 Protein ID WP_280109425.1
Coordinates 84413..84715 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name Rv0298 Uniprot ID -
Locus tag QDT91_RS29650 Protein ID WP_280109424.1
Coordinates 84189..84416 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDT91_RS29615 (QDT91_29610) 79301..79459 + 159 WP_165682270.1 hypothetical protein -
QDT91_RS29620 (QDT91_29615) 79484..81964 - 2481 WP_280109420.1 hypothetical protein -
QDT91_RS29625 (QDT91_29620) 81984..82655 - 672 WP_280109421.1 hypothetical protein -
QDT91_RS29630 (QDT91_29625) 82777..83034 - 258 WP_165682361.1 Txe/YoeB family addiction module toxin -
QDT91_RS29635 (QDT91_29630) 83031..83318 - 288 WP_280109422.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
QDT91_RS29640 (QDT91_29635) 83461..83676 + 216 WP_280109439.1 antitoxin -
QDT91_RS29645 (QDT91_29640) 83673..84089 + 417 WP_280109423.1 PIN domain-containing protein -
QDT91_RS29650 (QDT91_29645) 84189..84416 + 228 WP_280109424.1 ribbon-helix-helix protein, CopG family Antitoxin
QDT91_RS29655 (QDT91_29650) 84413..84715 + 303 WP_280109425.1 toxin Toxin
QDT91_RS29660 (QDT91_29655) 84804..86054 + 1251 WP_280109426.1 hypothetical protein -
QDT91_RS29665 (QDT91_29660) 86060..86500 - 441 WP_165682400.1 hypothetical protein -
QDT91_RS29670 (QDT91_29665) 86497..87042 - 546 WP_280109427.1 hypothetical protein -
QDT91_RS29675 (QDT91_29670) 87042..87674 - 633 WP_165682401.1 hypothetical protein -
QDT91_RS29680 (QDT91_29675) 87934..88656 - 723 WP_280109428.1 hypothetical protein -
QDT91_RS29685 (QDT91_29680) 88944..89558 + 615 WP_165682403.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..99865 99865


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Ribbon-helix-helix protein, CopG

(6-41)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 10599.26 Da        Isoelectric Point: 4.2658

>T278315 WP_280109425.1 NZ_CP122997:84413-84715 [Mycolicibacterium aubagnense]
VIAPGDICPRRDTSHEFYVVVLSNSIHLAADTGRVITCPYIPGQIPDAAMALVVRVEQPEGVALPELVQWLPTAALDEPI
GNIDITALRATTGLVTALVT

Download         Length: 303 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8151.16 Da        Isoelectric Point: 5.0348

>AT278315 WP_280109424.1 NZ_CP122997:84189-84416 [Mycolicibacterium aubagnense]
MAKDKVTVTVDQEVLAAADADAKAAGLNRSELVERALRHEHLRIALKSYTAETVPALNIDDYAQNIYEANRAAGL

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References