Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 78697..79247 | Replicon | plasmid unnamed5 |
| Accession | NZ_CP122997 | ||
| Organism | Mycolicibacterium aubagnense strain HPB1.1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | QDT91_RS29610 | Protein ID | WP_165682269.1 |
| Coordinates | 78921..79247 (+) | Length | 109 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | QDT91_RS29605 | Protein ID | WP_165682268.1 |
| Coordinates | 78697..78924 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDT91_RS29555 (QDT91_29550) | 74099..74470 | + | 372 | WP_280109412.1 | hypothetical protein | - |
| QDT91_RS29560 (QDT91_29555) | 74470..74841 | + | 372 | WP_280109413.1 | hypothetical protein | - |
| QDT91_RS29565 (QDT91_29560) | 74838..75245 | + | 408 | WP_280109414.1 | hypothetical protein | - |
| QDT91_RS29570 (QDT91_29565) | 75632..75868 | + | 237 | WP_280109415.1 | hypothetical protein | - |
| QDT91_RS29575 (QDT91_29570) | 75967..76191 | + | 225 | WP_280109416.1 | hypothetical protein | - |
| QDT91_RS29580 (QDT91_29575) | 76160..76363 | - | 204 | WP_280109417.1 | hypothetical protein | - |
| QDT91_RS29585 (QDT91_29580) | 76540..77226 | - | 687 | WP_280109418.1 | DUF2510 domain-containing protein | - |
| QDT91_RS29590 (QDT91_29585) | 77610..77843 | + | 234 | WP_280109419.1 | hypothetical protein | - |
| QDT91_RS29595 (QDT91_29590) | 78058..78294 | + | 237 | WP_165682266.1 | antitoxin | - |
| QDT91_RS29600 (QDT91_29595) | 78281..78652 | + | 372 | WP_165682267.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| QDT91_RS29605 (QDT91_29600) | 78697..78924 | + | 228 | WP_165682268.1 | antitoxin MazE family protein | Antitoxin |
| QDT91_RS29610 (QDT91_29605) | 78921..79247 | + | 327 | WP_165682269.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QDT91_RS29615 (QDT91_29610) | 79301..79459 | + | 159 | WP_165682270.1 | hypothetical protein | - |
| QDT91_RS29620 (QDT91_29615) | 79484..81964 | - | 2481 | WP_280109420.1 | hypothetical protein | - |
| QDT91_RS29625 (QDT91_29620) | 81984..82655 | - | 672 | WP_280109421.1 | hypothetical protein | - |
| QDT91_RS29630 (QDT91_29625) | 82777..83034 | - | 258 | WP_165682361.1 | Txe/YoeB family addiction module toxin | - |
| QDT91_RS29635 (QDT91_29630) | 83031..83318 | - | 288 | WP_280109422.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| QDT91_RS29640 (QDT91_29635) | 83461..83676 | + | 216 | WP_280109439.1 | antitoxin | - |
| QDT91_RS29645 (QDT91_29640) | 83673..84089 | + | 417 | WP_280109423.1 | PIN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..99865 | 99865 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11715.66 Da Isoelectric Point: 9.0641
>T278313 WP_165682269.1 NZ_CP122997:78921-79247 [Mycolicibacterium aubagnense]
VIRGEIWTASGRDYAGKPRPVLVVQDDRFDATDSVTICPLTTNDAGAPLLRIPLQPNAYNGLVTLSHIMVDKITTVPRAK
IGQRIGKISTTEMLQLERGLLVFLGMAG
VIRGEIWTASGRDYAGKPRPVLVVQDDRFDATDSVTICPLTTNDAGAPLLRIPLQPNAYNGLVTLSHIMVDKITTVPRAK
IGQRIGKISTTEMLQLERGLLVFLGMAG
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|