278313

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 78697..79247 Replicon plasmid unnamed5
Accession NZ_CP122997
Organism Mycolicibacterium aubagnense strain HPB1.1

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag QDT91_RS29610 Protein ID WP_165682269.1
Coordinates 78921..79247 (+) Length 109 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag QDT91_RS29605 Protein ID WP_165682268.1
Coordinates 78697..78924 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDT91_RS29555 (QDT91_29550) 74099..74470 + 372 WP_280109412.1 hypothetical protein -
QDT91_RS29560 (QDT91_29555) 74470..74841 + 372 WP_280109413.1 hypothetical protein -
QDT91_RS29565 (QDT91_29560) 74838..75245 + 408 WP_280109414.1 hypothetical protein -
QDT91_RS29570 (QDT91_29565) 75632..75868 + 237 WP_280109415.1 hypothetical protein -
QDT91_RS29575 (QDT91_29570) 75967..76191 + 225 WP_280109416.1 hypothetical protein -
QDT91_RS29580 (QDT91_29575) 76160..76363 - 204 WP_280109417.1 hypothetical protein -
QDT91_RS29585 (QDT91_29580) 76540..77226 - 687 WP_280109418.1 DUF2510 domain-containing protein -
QDT91_RS29590 (QDT91_29585) 77610..77843 + 234 WP_280109419.1 hypothetical protein -
QDT91_RS29595 (QDT91_29590) 78058..78294 + 237 WP_165682266.1 antitoxin -
QDT91_RS29600 (QDT91_29595) 78281..78652 + 372 WP_165682267.1 type II toxin-antitoxin system PemK/MazF family toxin -
QDT91_RS29605 (QDT91_29600) 78697..78924 + 228 WP_165682268.1 antitoxin MazE family protein Antitoxin
QDT91_RS29610 (QDT91_29605) 78921..79247 + 327 WP_165682269.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
QDT91_RS29615 (QDT91_29610) 79301..79459 + 159 WP_165682270.1 hypothetical protein -
QDT91_RS29620 (QDT91_29615) 79484..81964 - 2481 WP_280109420.1 hypothetical protein -
QDT91_RS29625 (QDT91_29620) 81984..82655 - 672 WP_280109421.1 hypothetical protein -
QDT91_RS29630 (QDT91_29625) 82777..83034 - 258 WP_165682361.1 Txe/YoeB family addiction module toxin -
QDT91_RS29635 (QDT91_29630) 83031..83318 - 288 WP_280109422.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
QDT91_RS29640 (QDT91_29635) 83461..83676 + 216 WP_280109439.1 antitoxin -
QDT91_RS29645 (QDT91_29640) 83673..84089 + 417 WP_280109423.1 PIN domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..99865 99865


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-103)

Antitoxin

Antitoxin MazE-like

(8-69)


Sequences

Toxin        


Download         Length: 109 a.a.        Molecular weight: 11715.66 Da        Isoelectric Point: 9.0641

>T278313 WP_165682269.1 NZ_CP122997:78921-79247 [Mycolicibacterium aubagnense]
VIRGEIWTASGRDYAGKPRPVLVVQDDRFDATDSVTICPLTTNDAGAPLLRIPLQPNAYNGLVTLSHIMVDKITTVPRAK
IGQRIGKISTTEMLQLERGLLVFLGMAG

Download         Length: 327 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8481.21 Da        Isoelectric Point: 4.5700

>AT278313 WP_165682268.1 NZ_CP122997:78697-78924 [Mycolicibacterium aubagnense]
MANRDINRRVADHRTRLREQGLRPLQIWVPDTRAPGFAEEAHRQSALVAASSSAAEDQAFVDNISQFNDEDFDAE

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References