278311

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 78058..78652 Replicon plasmid unnamed5
Accession NZ_CP122997
Organism Mycolicibacterium aubagnense strain HPB1.1

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag QDT91_RS29600 Protein ID WP_165682267.1
Coordinates 78281..78652 (+) Length 124 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag QDT91_RS29595 Protein ID WP_165682266.1
Coordinates 78058..78294 (+) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDT91_RS29550 (QDT91_29545) 73279..73608 + 330 WP_280109411.1 hypothetical protein -
QDT91_RS29555 (QDT91_29550) 74099..74470 + 372 WP_280109412.1 hypothetical protein -
QDT91_RS29560 (QDT91_29555) 74470..74841 + 372 WP_280109413.1 hypothetical protein -
QDT91_RS29565 (QDT91_29560) 74838..75245 + 408 WP_280109414.1 hypothetical protein -
QDT91_RS29570 (QDT91_29565) 75632..75868 + 237 WP_280109415.1 hypothetical protein -
QDT91_RS29575 (QDT91_29570) 75967..76191 + 225 WP_280109416.1 hypothetical protein -
QDT91_RS29580 (QDT91_29575) 76160..76363 - 204 WP_280109417.1 hypothetical protein -
QDT91_RS29585 (QDT91_29580) 76540..77226 - 687 WP_280109418.1 DUF2510 domain-containing protein -
QDT91_RS29590 (QDT91_29585) 77610..77843 + 234 WP_280109419.1 hypothetical protein -
QDT91_RS29595 (QDT91_29590) 78058..78294 + 237 WP_165682266.1 antitoxin Antitoxin
QDT91_RS29600 (QDT91_29595) 78281..78652 + 372 WP_165682267.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
QDT91_RS29605 (QDT91_29600) 78697..78924 + 228 WP_165682268.1 antitoxin MazE family protein -
QDT91_RS29610 (QDT91_29605) 78921..79247 + 327 WP_165682269.1 type II toxin-antitoxin system PemK/MazF family toxin -
QDT91_RS29615 (QDT91_29610) 79301..79459 + 159 WP_165682270.1 hypothetical protein -
QDT91_RS29620 (QDT91_29615) 79484..81964 - 2481 WP_280109420.1 hypothetical protein -
QDT91_RS29625 (QDT91_29620) 81984..82655 - 672 WP_280109421.1 hypothetical protein -
QDT91_RS29630 (QDT91_29625) 82777..83034 - 258 WP_165682361.1 Txe/YoeB family addiction module toxin -
QDT91_RS29635 (QDT91_29630) 83031..83318 - 288 WP_280109422.1 type II toxin-antitoxin system Phd/YefM family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..99865 99865


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(5-114)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 124 a.a.        Molecular weight: 13210.17 Da        Isoelectric Point: 8.0847

>T278311 WP_165682267.1 NZ_CP122997:78281-78652 [Mycolicibacterium aubagnense]
MASTEPRRGELWLAALGAGRAGEPAKHRPAVVVSADDLLTGEPTELVVVVPVSSSRTSTPLRPTIRPNEGVETDSVAVCR
AIRGMARARLVRHLGTLDTHTMDAIEKSLALILDIEQPGRRDK

Download         Length: 372 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8642.39 Da        Isoelectric Point: 4.1357

>AT278311 WP_165682266.1 NZ_CP122997:78058-78294 [Mycolicibacterium aubagnense]
VSTPTTTIRVPVTTRDRLNAQARDRGISVVALLDEWSNRAERDAAFAAERAATLAEATNQAILEEDRDWEQTETDGLD

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References