Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 5018116..5018774 | Replicon | chromosome |
Accession | NZ_CP122994 | ||
Organism | Mycolicibacterium aubagnense strain HPB1.1 |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | - |
Locus tag | QDT91_RS24210 | Protein ID | WP_138228594.1 |
Coordinates | 5018116..5018553 (-) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | - |
Locus tag | QDT91_RS24215 | Protein ID | WP_138228593.1 |
Coordinates | 5018556..5018774 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDT91_RS24185 (QDT91_24180) | 5013212..5013460 | - | 249 | WP_138228598.1 | hypothetical protein | - |
QDT91_RS24190 (QDT91_24185) | 5013571..5014770 | + | 1200 | WP_138228597.1 | acetyl-CoA acetyltransferase | - |
QDT91_RS24195 (QDT91_24190) | 5014767..5016263 | + | 1497 | WP_138228596.1 | carotenoid oxygenase family protein | - |
QDT91_RS24200 (QDT91_24195) | 5016263..5017153 | + | 891 | WP_179970220.1 | winged helix-turn-helix transcriptional regulator | - |
QDT91_RS24205 (QDT91_24200) | 5017205..5017975 | - | 771 | WP_138228595.1 | VOC family protein | - |
QDT91_RS24210 (QDT91_24205) | 5018116..5018553 | - | 438 | WP_138228594.1 | SRPBCC family protein | Toxin |
QDT91_RS24215 (QDT91_24210) | 5018556..5018774 | - | 219 | WP_138228593.1 | antitoxin | Antitoxin |
QDT91_RS24220 (QDT91_24215) | 5018824..5021238 | - | 2415 | WP_138228592.1 | cation-translocating P-type ATPase | - |
QDT91_RS24225 (QDT91_24220) | 5021315..5022424 | - | 1110 | WP_138228591.1 | MBL fold metallo-hydrolase | - |
QDT91_RS24230 (QDT91_24225) | 5022424..5023158 | - | 735 | WP_138228590.1 | enoyl-CoA hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15577.05 Da Isoelectric Point: 9.5948
>T278310 WP_138228594.1 NZ_CP122994:c5018553-5018116 [Mycolicibacterium aubagnense]
MAKLASSIEVPLSPEKAWEAASDLSRYDDWLSIHRMWRSTLPETLGKGTQISSVVEVKGMLNRVDWTIVHYNPPGSLTLN
GVGKGGVRVKLMAKITPAEAGSNVAFDVHLGGPALFGPIGMVVAAALRSDIHHSLEKFKALFASV
MAKLASSIEVPLSPEKAWEAASDLSRYDDWLSIHRMWRSTLPETLGKGTQISSVVEVKGMLNRVDWTIVHYNPPGSLTLN
GVGKGGVRVKLMAKITPAEAGSNVAFDVHLGGPALFGPIGMVVAAALRSDIHHSLEKFKALFASV
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|