Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RHH
Location 16067..16623 Replicon plasmid unnamed2
Accession NZ_CP122989
Organism Aeromonas salmonicida strain JNG

Toxin (Protein)


Gene name relE Uniprot ID A0A2H9U809
Locus tag QDU35_RS23335 Protein ID WP_042468953.1
Coordinates 16348..16623 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag QDU35_RS23330 Protein ID WP_174416604.1
Coordinates 16067..16348 (+) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDU35_RS23315 (QDU35_23315) 11554..12228 - 675 Protein_16 IS21 family transposase -
QDU35_RS23320 (QDU35_23320) 12263..15291 - 3029 Protein_17 Tn3 family transposase -
QDU35_RS23325 (QDU35_23325) 15295..15855 - 561 WP_042468955.1 recombinase family protein -
QDU35_RS23330 (QDU35_23330) 16067..16348 + 282 WP_174416604.1 ribbon-helix-helix domain-containing protein Antitoxin
QDU35_RS23335 (QDU35_23335) 16348..16623 + 276 WP_042468953.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDU35_RS23340 (QDU35_23340) 17410..18324 + 915 WP_042468951.1 TOMM precursor leader peptide-binding protein -
QDU35_RS23345 (QDU35_23345) 18326..18511 + 186 WP_088814096.1 hypothetical protein -
QDU35_RS23350 (QDU35_23350) 18560..19477 + 918 WP_076611341.1 IS5-like element ISAs4 family transposase -
QDU35_RS23355 (QDU35_23355) 19672..20703 + 1032 WP_088814095.1 IS630 family transposase -
QDU35_RS23360 (QDU35_23360) 20684..20872 + 189 WP_198318209.1 YcaO-like family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ascR / ascS / ascT / ascU / sycO / aopO / ati2 / ati2 / ati1 / ascL / ascK / ascJ / ascI / ascH / ascG / ascF / ascE / ascD / ascC / ascB / exsD / exsA / exsB / exsE / exsC / aopD / aopB / acrH / acrV / acrG / acrR / ascV / ascY / ascX / acr2 / acr1 / aopN / ascN / ascO / ascP 1..62485 62485
- inside IScluster/Tn - sycO / aopO 3096..27214 24118


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-50)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10685.43 Da        Isoelectric Point: 9.5291

>T278309 WP_042468953.1 NZ_CP122989:16348-16623 [Aeromonas salmonicida]
MELKWTSKALSDLARLYEFLALANKPAAARAVQALTQAPTILLTNPRIGEQLFQFEPREVRRILVGEYEVRYEILDSIIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10351.80 Da        Isoelectric Point: 5.6624

>AT278309 WP_174416604.1 NZ_CP122989:16067-16348 [Aeromonas salmonicida]
MKGNMTQATTKVLTAHVPLPMADKVDQMAARLERSRGWIMKQALSAWLAQEEDRDRLTQEALADVDAGRVIDHLAVQAWA
DSLNTDQPLSVPR

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2H9U809

Antitoxin

Source ID Structure

References