Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 3363507..3364126 | Replicon | chromosome |
Accession | NZ_CP122987 | ||
Organism | Aeromonas salmonicida strain JNG |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | QDU35_RS15885 | Protein ID | WP_085044624.1 |
Coordinates | 3363507..3363803 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QDU35_RS15890 | Protein ID | WP_085044625.1 |
Coordinates | 3363806..3364126 (+) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDU35_RS15860 (QDU35_15860) | 3358807..3359043 | + | 237 | WP_139804925.1 | hypothetical protein | - |
QDU35_RS15865 (QDU35_15865) | 3359040..3359921 | + | 882 | WP_085044620.1 | hypothetical protein | - |
QDU35_RS15870 (QDU35_15870) | 3359918..3360466 | + | 549 | WP_085044621.1 | hypothetical protein | - |
QDU35_RS15875 (QDU35_15875) | 3360463..3362076 | + | 1614 | WP_085044622.1 | hypothetical protein | - |
QDU35_RS15880 (QDU35_15880) | 3362088..3362786 | + | 699 | WP_085044623.1 | phage virion morphogenesis protein | - |
QDU35_RS15885 (QDU35_15885) | 3363507..3363803 | + | 297 | WP_085044624.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QDU35_RS15890 (QDU35_15890) | 3363806..3364126 | + | 321 | WP_085044625.1 | putative addiction module antidote protein | Antitoxin |
QDU35_RS15895 (QDU35_15895) | 3364345..3365712 | + | 1368 | WP_085044626.1 | hypothetical protein | - |
QDU35_RS15900 (QDU35_15900) | 3366433..3367344 | + | 912 | WP_042468381.1 | LysR family transcriptional regulator | - |
QDU35_RS15905 (QDU35_15905) | 3367561..3367911 | + | 351 | WP_005312972.1 | ArsC family reductase | - |
QDU35_RS15910 (QDU35_15910) | 3367931..3369058 | + | 1128 | WP_005312969.1 | succinyl-diaminopimelate desuccinylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3333427..3365712 | 32285 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11025.77 Da Isoelectric Point: 10.1760
>T278307 WP_085044624.1 NZ_CP122987:3363507-3363803 [Aeromonas salmonicida]
MREIIKTNVFDRWFDSLRDARAQAKVTARIRRLGLGNPGDVKPIGEGLSEMRIDYGPGYRVYFMTKGPIIIVLLCGGDKG
TQARDIEQAKTIAAQWKD
MREIIKTNVFDRWFDSLRDARAQAKVTARIRRLGLGNPGDVKPIGEGLSEMRIDYGPGYRVYFMTKGPIIIVLLCGGDKG
TQARDIEQAKTIAAQWKD
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|