Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 496275..496915 | Replicon | chromosome |
Accession | NZ_CP122987 | ||
Organism | Aeromonas salmonicida strain JNG |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A807Z4U5 |
Locus tag | QDU35_RS02445 | Protein ID | WP_005320982.1 |
Coordinates | 496275..496688 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | A0A807Z5T0 |
Locus tag | QDU35_RS02450 | Protein ID | WP_005320985.1 |
Coordinates | 496685..496915 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDU35_RS02420 (QDU35_02420) | 492650..493267 | + | 618 | WP_225854306.1 | subclass B2 metallo-beta-lactamase | - |
QDU35_RS02425 (QDU35_02425) | 493415..494332 | + | 918 | WP_088814123.1 | IS5-like element ISAs4 family transposase | - |
QDU35_RS02430 (QDU35_02430) | 494567..495484 | + | 918 | WP_076611341.1 | IS5-like element ISAs4 family transposase | - |
QDU35_RS02435 (QDU35_02435) | 495488..495808 | - | 321 | WP_232479382.1 | hypothetical protein | - |
QDU35_RS02440 (QDU35_02440) | 495844..496197 | - | 354 | WP_017413138.1 | hypothetical protein | - |
QDU35_RS02445 (QDU35_02445) | 496275..496688 | - | 414 | WP_005320982.1 | PIN domain-containing protein | Toxin |
QDU35_RS02450 (QDU35_02450) | 496685..496915 | - | 231 | WP_005320985.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QDU35_RS02455 (QDU35_02455) | 496984..497289 | - | 306 | WP_225854310.1 | integrase | - |
QDU35_RS02460 (QDU35_02460) | 497283..497672 | - | 390 | WP_139403308.1 | site-specific integrase | - |
QDU35_RS02465 (QDU35_02465) | 498089..499006 | - | 918 | WP_076611341.1 | IS5-like element ISAs4 family transposase | - |
QDU35_RS02475 (QDU35_02475) | 501161..501496 | + | 336 | WP_157668971.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 491179..502554 | 11375 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14935.23 Da Isoelectric Point: 5.7146
>T278306 WP_005320982.1 NZ_CP122987:c496688-496275 [Aeromonas salmonicida]
VKTFMLDTCICSFIMREMPQSVLERLGAEVASGNRIVISAITYAEMRYGQIGKKASPKLGPAIDEFVRRLDGILPWDAAT
VDQTLEVRQQLAALGTPIGNNDAAIAAHALTAGCVLVTNNTREFSRVAGLLYEDWVH
VKTFMLDTCICSFIMREMPQSVLERLGAEVASGNRIVISAITYAEMRYGQIGKKASPKLGPAIDEFVRRLDGILPWDAAT
VDQTLEVRQQLAALGTPIGNNDAAIAAHALTAGCVLVTNNTREFSRVAGLLYEDWVH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A807Z4U5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A807Z5T0 |