Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 734973..735604 | Replicon | chromosome |
| Accession | NZ_CP122962 | ||
| Organism | Agrobacterium tumefaciens strain CFBP5506 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | CFBP5506_RS03655 | Protein ID | WP_080790996.1 |
| Coordinates | 735206..735604 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A420GCG3 |
| Locus tag | CFBP5506_RS03650 | Protein ID | WP_031233980.1 |
| Coordinates | 734973..735206 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CFBP5506_RS03625 (CFBP5506_03625) | 729978..730214 | + | 237 | WP_003502080.1 | acyl carrier protein | - |
| CFBP5506_RS03630 (CFBP5506_03630) | 730465..731727 | + | 1263 | WP_080791000.1 | beta-ketoacyl-ACP synthase II | - |
| CFBP5506_RS03635 (CFBP5506_03635) | 732036..733256 | + | 1221 | WP_080790999.1 | endolytic transglycosylase MltG | - |
| CFBP5506_RS03640 (CFBP5506_03640) | 733324..734211 | + | 888 | WP_080790998.1 | YicC/YloC family endoribonuclease | - |
| CFBP5506_RS03645 (CFBP5506_03645) | 734216..734878 | + | 663 | WP_080790997.1 | guanylate kinase | - |
| CFBP5506_RS03650 (CFBP5506_03650) | 734973..735206 | + | 234 | WP_031233980.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| CFBP5506_RS03655 (CFBP5506_03655) | 735206..735604 | + | 399 | WP_080790996.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| CFBP5506_RS03660 (CFBP5506_03660) | 735621..736454 | - | 834 | WP_080790995.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| CFBP5506_RS03665 (CFBP5506_03665) | 736454..737476 | - | 1023 | WP_080790994.1 | 4-hydroxythreonine-4-phosphate dehydrogenase PdxA | - |
| CFBP5506_RS03670 (CFBP5506_03670) | 737502..738449 | - | 948 | WP_080790993.1 | peptidylprolyl isomerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14927.20 Da Isoelectric Point: 6.2251
>T278305 WP_080790996.1 NZ_CP122962:735206-735604 [Agrobacterium tumefaciens]
MLTYMLDTNICIYVMKTYPPELREKFNDLADQLCISSITLGELYYGAEKSVRRQENISAIENFTARLEVLPFADKGAAHY
GQIRAELTKVGTPCGVHDMQIGGHARSEGLIVVTNNMREFIRMPGLRAENWV
MLTYMLDTNICIYVMKTYPPELREKFNDLADQLCISSITLGELYYGAEKSVRRQENISAIENFTARLEVLPFADKGAAHY
GQIRAELTKVGTPCGVHDMQIGGHARSEGLIVVTNNMREFIRMPGLRAENWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|