Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF-MazE |
| Location | 573837..574462 | Replicon | chromosome |
| Accession | NZ_CP122962 | ||
| Organism | Agrobacterium tumefaciens strain CFBP5506 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | CFBP5506_RS02825 | Protein ID | WP_080791104.1 |
| Coordinates | 574103..574462 (+) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A420FBH4 |
| Locus tag | CFBP5506_RS02820 | Protein ID | WP_059753836.1 |
| Coordinates | 573837..574103 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CFBP5506_RS02800 (CFBP5506_02800) | 569312..570136 | + | 825 | WP_080791107.1 | class D beta-lactamase | - |
| CFBP5506_RS02805 (CFBP5506_02805) | 570513..573095 | + | 2583 | WP_162927402.1 | heavy metal translocating P-type ATPase | - |
| CFBP5506_RS02810 (CFBP5506_02810) | 573092..573514 | + | 423 | WP_080791106.1 | Cu(I)-responsive transcriptional regulator | - |
| CFBP5506_RS02815 (CFBP5506_02815) | 573567..573767 | + | 201 | WP_080791105.1 | heavy-metal-associated domain-containing protein | - |
| CFBP5506_RS02820 (CFBP5506_02820) | 573837..574103 | + | 267 | WP_059753836.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| CFBP5506_RS02825 (CFBP5506_02825) | 574103..574462 | + | 360 | WP_080791104.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| CFBP5506_RS02830 (CFBP5506_02830) | 574483..574731 | - | 249 | WP_077982678.1 | hypothetical protein | - |
| CFBP5506_RS02835 (CFBP5506_02835) | 574909..576306 | + | 1398 | WP_169538621.1 | MFS transporter | - |
| CFBP5506_RS02840 (CFBP5506_02840) | 576324..576497 | - | 174 | WP_077982677.1 | hypothetical protein | - |
| CFBP5506_RS02845 (CFBP5506_02845) | 576566..578281 | - | 1716 | WP_121459694.1 | glycoside hydrolase family 32 protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 12841.93 Da Isoelectric Point: 7.7513
>T278304 WP_080791104.1 NZ_CP122962:574103-574462 [Agrobacterium tumefaciens]
MVRSQVPKRGDVYLVDLNPVIGSEISDEHRCIVITPREINAVGLCLVVPVNTGGLFTRRAGLAVNISGHKTTGVALCNQV
RSMDIVARASQKKAKYIETLDDATIDEIVGRVISMIDPA
MVRSQVPKRGDVYLVDLNPVIGSEISDEHRCIVITPREINAVGLCLVVPVNTGGLFTRRAGLAVNISGHKTTGVALCNQV
RSMDIVARASQKKAKYIETLDDATIDEIVGRVISMIDPA
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|