Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pasABC/RelE-HTH |
| Location | 318536..319016 | Replicon | chromosome |
| Accession | NZ_CP122962 | ||
| Organism | Agrobacterium tumefaciens strain CFBP5506 | ||
Toxin (Protein)
| Gene name | pasB | Uniprot ID | - |
| Locus tag | CFBP5506_RS01525 | Protein ID | WP_080791291.1 |
| Coordinates | 318536..318805 (-) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | pasA | Uniprot ID | - |
| Locus tag | CFBP5506_RS01530 | Protein ID | WP_080791290.1 |
| Coordinates | 318789..319016 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CFBP5506_RS01495 (CFBP5506_01495) | 313599..314375 | - | 777 | WP_080791296.1 | L,D-transpeptidase | - |
| CFBP5506_RS01500 (CFBP5506_01500) | 314611..315240 | + | 630 | WP_080791295.1 | DNA-3-methyladenine glycosylase I | - |
| CFBP5506_RS01505 (CFBP5506_01505) | 315237..315680 | + | 444 | WP_080791294.1 | hypothetical protein | - |
| CFBP5506_RS01510 (CFBP5506_01510) | 315696..316739 | - | 1044 | WP_121459701.1 | YeiH family protein | - |
| CFBP5506_RS01515 (CFBP5506_01515) | 316822..317739 | + | 918 | WP_080791293.1 | LysR family transcriptional regulator | - |
| CFBP5506_RS01520 (CFBP5506_01520) | 317765..318529 | - | 765 | WP_080791292.1 | hypothetical protein | - |
| CFBP5506_RS01525 (CFBP5506_01525) | 318536..318805 | - | 270 | WP_080791291.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| CFBP5506_RS01530 (CFBP5506_01530) | 318789..319016 | - | 228 | WP_080791290.1 | DUF6290 family protein | Antitoxin |
| CFBP5506_RS01535 (CFBP5506_01535) | 319251..320774 | + | 1524 | WP_080791289.1 | histidine--tRNA ligase | - |
| CFBP5506_RS01540 (CFBP5506_01540) | 320779..321147 | + | 369 | WP_080791288.1 | VOC family protein | - |
| CFBP5506_RS01545 (CFBP5506_01545) | 321164..322291 | + | 1128 | WP_080791287.1 | ATP phosphoribosyltransferase regulatory subunit | - |
| CFBP5506_RS01550 (CFBP5506_01550) | 322288..322980 | + | 693 | WP_080791286.1 | ATP phosphoribosyltransferase | - |
| CFBP5506_RS01555 (CFBP5506_01555) | 323040..323486 | - | 447 | WP_080791285.1 | DoxX family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10774.42 Da Isoelectric Point: 9.5684
>T278303 WP_080791291.1 NZ_CP122962:c318805-318536 [Agrobacterium tumefaciens]
VIWTIEYDTLVQKEMRKIHPEVRRRIRSFLHERIAALDDPRQTGTTLQGSELGNFWRYRVGDYRIICDIQDHKLVVLVVE
IGHRREIYR
VIWTIEYDTLVQKEMRKIHPEVRRRIRSFLHERIAALDDPRQTGTTLQGSELGNFWRYRVGDYRIICDIQDHKLVVLVVE
IGHRREIYR
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|