Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ(toxin) |
| Location | 587394..588018 | Replicon | chromosome |
| Accession | NZ_CP122956 | ||
| Organism | Helicobacter pylori strain BT112 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QAD58_RS02855 | Protein ID | WP_286448704.1 |
| Coordinates | 587752..588018 (+) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | E6NNW2 |
| Locus tag | QAD58_RS02850 | Protein ID | WP_001133862.1 |
| Coordinates | 587394..587771 (+) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QAD58_RS02825 (QAD58_02830) | 582408..583520 | + | 1113 | WP_286448701.1 | hydrogenase formation protein HypD | - |
| QAD58_RS02830 (QAD58_02835) | 583471..583992 | - | 522 | WP_286448702.1 | hypothetical protein | - |
| QAD58_RS02845 (QAD58_02850) | 584498..586714 | + | 2217 | WP_286448703.1 | Hop family adhesin BabA | - |
| QAD58_RS02850 (QAD58_02855) | 587394..587771 | + | 378 | WP_001133862.1 | hypothetical protein | Antitoxin |
| QAD58_RS02855 (QAD58_02860) | 587752..588018 | + | 267 | WP_286448704.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| QAD58_RS02860 (QAD58_02865) | 588097..588408 | + | 312 | WP_120923865.1 | type II toxin-antitoxin system antitoxin | - |
| QAD58_RS02865 (QAD58_02870) | 588395..588532 | + | 138 | Protein_544 | type II toxin-antitoxin system YafQ family toxin | - |
| QAD58_RS02870 (QAD58_02875) | 588586..589107 | - | 522 | WP_286446122.1 | acyl-CoA thioesterase | - |
| QAD58_RS02875 (QAD58_02880) | 589247..590089 | + | 843 | WP_286448706.1 | SDR family oxidoreductase | - |
| QAD58_RS02880 (QAD58_02885) | 590082..591062 | + | 981 | WP_000921452.1 | iron ABC transporter permease | - |
| QAD58_RS02885 (QAD58_02890) | 591062..591829 | + | 768 | WP_220884645.1 | ABC transporter ATP-binding protein | - |
| QAD58_RS02890 (QAD58_02895) | 591906..593018 | + | 1113 | WP_286448993.1 | glycosyltransferase family 8 protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10318.14 Da Isoelectric Point: 8.0602
>T278298 WP_286448704.1 NZ_CP122956:587752-588018 [Helicobacter pylori]
VLKLNLKKSFQKDFDKLLLNGFDDSVLNEVILTLRKKEPLDPQFQDHALKGKWKPFRECHIKADILLVYLVKDDELVLLR
LGSHSELF
VLKLNLKKSFQKDFDKLLLNGFDDSVLNEVILTLRKKEPLDPQFQDHALKGKWKPFRECHIKADILLVYLVKDDELVLLR
LGSHSELF
Download Length: 267 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14720.68 Da Isoelectric Point: 7.7778
>AT278298 WP_001133862.1 NZ_CP122956:587394-587771 [Helicobacter pylori]
MPNSPTKKDYTQYSEKQLFNLINQLEQKIKKMQNDRASFKEKMAKELEKRDQNFKDKIDALNELLQKISQAFDDKRDCCL
GRKIPNLETQQAMRDALNKETDLIVEDFSSYSDERKRALGVETQP
MPNSPTKKDYTQYSEKQLFNLINQLEQKIKKMQNDRASFKEKMAKELEKRDQNFKDKIDALNELLQKISQAFDDKRDCCL
GRKIPNLETQQAMRDALNKETDLIVEDFSSYSDERKRALGVETQP
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|