Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ(toxin) |
Location | 578766..579390 | Replicon | chromosome |
Accession | NZ_CP122951 | ||
Organism | Helicobacter pylori strain BS26 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A6UH71 |
Locus tag | QAD59_RS02815 | Protein ID | WP_025455067.1 |
Coordinates | 579124..579390 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QAD59_RS02810 | Protein ID | WP_286490397.1 |
Coordinates | 578766..579143 (+) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QAD59_RS02785 (QAD59_02790) | 574001..575113 | + | 1113 | WP_286490394.1 | hydrogenase formation protein HypD | - |
QAD59_RS02790 (QAD59_02795) | 575064..575585 | - | 522 | WP_286490395.1 | hypothetical protein | - |
QAD59_RS02805 (QAD59_02810) | 576092..578314 | + | 2223 | WP_286490396.1 | Hop family adhesin BabA | - |
QAD59_RS02810 (QAD59_02815) | 578766..579143 | + | 378 | WP_286490397.1 | hypothetical protein | Antitoxin |
QAD59_RS02815 (QAD59_02820) | 579124..579390 | + | 267 | WP_025455067.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
QAD59_RS02820 (QAD59_02825) | 579495..580019 | - | 525 | WP_001120211.1 | acyl-CoA thioesterase | - |
QAD59_RS02825 (QAD59_02830) | 580160..581002 | + | 843 | WP_286490399.1 | SDR family oxidoreductase | - |
QAD59_RS02830 (QAD59_02835) | 580995..581975 | + | 981 | WP_000921452.1 | iron ABC transporter permease | - |
QAD59_RS02835 (QAD59_02840) | 581975..582742 | + | 768 | WP_000242366.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10303.17 Da Isoelectric Point: 9.6292
>T278293 WP_025455067.1 NZ_CP122951:579124-579390 [Helicobacter pylori]
VLKLNLKKSFQKDFDKLLLNGFDDSVLNKVILSLRKKEPLDPQFQDHALKGKWKPFRECHIKADILLVYLVKDDELILVR
LGSHSELF
VLKLNLKKSFQKDFDKLLLNGFDDSVLNKVILSLRKKEPLDPQFQDHALKGKWKPFRECHIKADILLVYLVKDDELILVR
LGSHSELF
Download Length: 267 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14806.82 Da Isoelectric Point: 9.0112
>AT278293 WP_286490397.1 NZ_CP122951:578766-579143 [Helicobacter pylori]
MPNSPTKKDYTRYSEKQLFNLINQLERKIKKMQNDRTSFKEKMAKELEKRDQNFKDKIDALNELLQKISQAFDDKRDCCL
GRKIPNLETQQAMRDALNKETDLIVEDFSSYSDERKRALGVETQP
MPNSPTKKDYTRYSEKQLFNLINQLERKIKKMQNDRTSFKEKMAKELEKRDQNFKDKIDALNELLQKISQAFDDKRDCCL
GRKIPNLETQQAMRDALNKETDLIVEDFSSYSDERKRALGVETQP
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|