Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ(toxin) |
Location | 1078165..1078789 | Replicon | chromosome |
Accession | NZ_CP122946 | ||
Organism | Helicobacter pylori strain BS31 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A6UH71 |
Locus tag | QAP07_RS05105 | Protein ID | WP_025455067.1 |
Coordinates | 1078165..1078431 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QAP07_RS05110 | Protein ID | WP_286443894.1 |
Coordinates | 1078412..1078789 (-) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QAP07_RS05085 (QAP07_05085) | 1074807..1075574 | - | 768 | WP_000242349.1 | ABC transporter ATP-binding protein | - |
QAP07_RS05090 (QAP07_05090) | 1075574..1076554 | - | 981 | WP_000921461.1 | iron ABC transporter permease | - |
QAP07_RS05095 (QAP07_05095) | 1076547..1077395 | - | 849 | WP_286443886.1 | SDR family oxidoreductase | - |
QAP07_RS05100 (QAP07_05100) | 1077536..1078060 | + | 525 | WP_121297461.1 | acyl-CoA thioesterase | - |
QAP07_RS05105 (QAP07_05105) | 1078165..1078431 | - | 267 | WP_025455067.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
QAP07_RS05110 (QAP07_05110) | 1078412..1078789 | - | 378 | WP_286443894.1 | hypothetical protein | Antitoxin |
QAP07_RS05115 (QAP07_05115) | 1078870..1079136 | - | 267 | WP_101003364.1 | type II toxin-antitoxin system YafQ family toxin | - |
QAP07_RS05120 (QAP07_05120) | 1079123..1079494 | - | 372 | WP_286443900.1 | hypothetical protein | - |
QAP07_RS05125 (QAP07_05125) | 1080143..1082365 | - | 2223 | WP_286443903.1 | Hop family adhesin BabA | - |
QAP07_RS05140 (QAP07_05140) | 1082885..1083406 | + | 522 | WP_286443905.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10303.17 Da Isoelectric Point: 9.6292
>T278284 WP_025455067.1 NZ_CP122946:c1078431-1078165 [Helicobacter pylori]
VLKLNLKKSFQKDFDKLLLNGFDDSVLNKVILSLRKKEPLDPQFQDHALKGKWKPFRECHIKADILLVYLVKDDELILVR
LGSHSELF
VLKLNLKKSFQKDFDKLLLNGFDDSVLNKVILSLRKKEPLDPQFQDHALKGKWKPFRECHIKADILLVYLVKDDELILVR
LGSHSELF
Download Length: 267 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14622.58 Da Isoelectric Point: 8.4602
>AT278284 WP_286443894.1 NZ_CP122946:c1078789-1078412 [Helicobacter pylori]
MPNTTAKKDYTQYSEKQLFNLINQLEQKIKKMQNDRASFKEKMAKELDKRDQNFKDKIDALNGLLQKISQAFDDKRDCCL
GRKIPNLETQQAMRDALNKETDLIVEDFSSYSDERKRALGVETQP
MPNTTAKKDYTQYSEKQLFNLINQLEQKIKKMQNDRASFKEKMAKELDKRDQNFKDKIDALNGLLQKISQAFDDKRDCCL
GRKIPNLETQQAMRDALNKETDLIVEDFSSYSDERKRALGVETQP
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|