Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 21301..21902 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP122941 | ||
| Organism | Escherichia coli strain ETEC1701 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9YA20 |
| Locus tag | QDX07_RS25460 | Protein ID | WP_001216045.1 |
| Coordinates | 21301..21681 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | QDX07_RS25465 | Protein ID | WP_001190712.1 |
| Coordinates | 21681..21902 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX07_RS25430 (QDX07_25430) | 16428..16658 | - | 231 | Protein_13 | ash family protein | - |
| QDX07_RS25435 (QDX07_25435) | 16742..18184 | - | 1443 | WP_223656860.1 | terminase | - |
| QDX07_RS25440 (QDX07_25440) | 18226..19419 | - | 1194 | WP_063085178.1 | hypothetical protein | - |
| QDX07_RS25445 (QDX07_25445) | 19505..19957 | - | 453 | WP_001326849.1 | late promoter-activating protein | - |
| QDX07_RS25450 (QDX07_25450) | 20046..21089 | - | 1044 | WP_063085179.1 | DUF968 domain-containing protein | - |
| QDX07_RS25455 (QDX07_25455) | 21117..21296 | - | 180 | WP_000113018.1 | hypothetical protein | - |
| QDX07_RS25460 (QDX07_25460) | 21301..21681 | - | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| QDX07_RS25465 (QDX07_25465) | 21681..21902 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QDX07_RS25470 (QDX07_25470) | 22085..23641 | + | 1557 | WP_086186057.1 | type I restriction-modification system subunit M | - |
| QDX07_RS25475 (QDX07_25475) | 23638..24291 | + | 654 | Protein_22 | restriction endonuclease subunit S | - |
| QDX07_RS25485 (QDX07_25485) | 25769..26179 | + | 411 | Protein_24 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..96600 | 96600 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T278282 WP_001216045.1 NZ_CP122941:c21681-21301 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CLP7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |