Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 21301..21902 Replicon plasmid unnamed3
Accession NZ_CP122941
Organism Escherichia coli strain ETEC1701

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag QDX07_RS25460 Protein ID WP_001216045.1
Coordinates 21301..21681 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QDX07_RS25465 Protein ID WP_001190712.1
Coordinates 21681..21902 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX07_RS25430 (QDX07_25430) 16428..16658 - 231 Protein_13 ash family protein -
QDX07_RS25435 (QDX07_25435) 16742..18184 - 1443 WP_223656860.1 terminase -
QDX07_RS25440 (QDX07_25440) 18226..19419 - 1194 WP_063085178.1 hypothetical protein -
QDX07_RS25445 (QDX07_25445) 19505..19957 - 453 WP_001326849.1 late promoter-activating protein -
QDX07_RS25450 (QDX07_25450) 20046..21089 - 1044 WP_063085179.1 DUF968 domain-containing protein -
QDX07_RS25455 (QDX07_25455) 21117..21296 - 180 WP_000113018.1 hypothetical protein -
QDX07_RS25460 (QDX07_25460) 21301..21681 - 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QDX07_RS25465 (QDX07_25465) 21681..21902 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QDX07_RS25470 (QDX07_25470) 22085..23641 + 1557 WP_086186057.1 type I restriction-modification system subunit M -
QDX07_RS25475 (QDX07_25475) 23638..24291 + 654 Protein_22 restriction endonuclease subunit S -
QDX07_RS25485 (QDX07_25485) 25769..26179 + 411 Protein_24 restriction endonuclease subunit S -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..96600 96600


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T278282 WP_001216045.1 NZ_CP122941:c21681-21301 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT278282 WP_001190712.1 NZ_CP122941:c21902-21681 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References