Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4585850..4586685 | Replicon | chromosome |
Accession | NZ_CP122938 | ||
Organism | Escherichia coli strain ETEC1701 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A3A6S2N5 |
Locus tag | QDX07_RS22700 | Protein ID | WP_000854800.1 |
Coordinates | 4586308..4586685 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A3Z2YIX3 |
Locus tag | QDX07_RS22695 | Protein ID | WP_032178229.1 |
Coordinates | 4585850..4586218 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX07_RS22670 (4582961) | 4582961..4583779 | + | 819 | WP_001234392.1 | DUF932 domain-containing protein | - |
QDX07_RS22675 (4583871) | 4583871..4584356 | + | 486 | WP_000213706.1 | antirestriction protein | - |
QDX07_RS22680 (4584371) | 4584371..4584847 | + | 477 | WP_001186784.1 | RadC family protein | - |
QDX07_RS22685 (4584916) | 4584916..4585137 | + | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
QDX07_RS22690 (4585156) | 4585156..4585800 | + | 645 | WP_000086748.1 | hypothetical protein | - |
QDX07_RS22695 (4585850) | 4585850..4586218 | + | 369 | WP_032178229.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QDX07_RS22700 (4586308) | 4586308..4586685 | + | 378 | WP_000854800.1 | TA system toxin CbtA family protein | Toxin |
QDX07_RS22705 (4586682) | 4586682..4587170 | + | 489 | WP_000779171.1 | DUF5983 family protein | - |
QDX07_RS22710 (4587182) | 4587182..4587379 | + | 198 | WP_001374283.1 | DUF957 domain-containing protein | - |
QDX07_RS22715 (4587464) | 4587464..4588306 | + | 843 | WP_063086391.1 | DUF4942 domain-containing protein | - |
QDX07_RS22720 (4589055) | 4589055..4590593 | + | 1539 | WP_001187196.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4559155..4598406 | 39251 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14068.13 Da Isoelectric Point: 9.1376
>T278279 WP_000854800.1 NZ_CP122938:4586308-4586685 [Escherichia coli]
MKTLPVLPGQAAGLRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDKPGF
NACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHSEAKR
MKTLPVLPGQAAGLRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDKPGF
NACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHSEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13823.58 Da Isoelectric Point: 6.3177
>AT278279 WP_032178229.1 NZ_CP122938:4585850-4586218 [Escherichia coli]
VSDTLHETNYPDDNNDRSWWGLPCTVTPCFRARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLHETNYPDDNNDRSWWGLPCTVTPCFRARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3A6S2N5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z2YIX3 |