Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3785836..3786454 | Replicon | chromosome |
Accession | NZ_CP122938 | ||
Organism | Escherichia coli strain ETEC1701 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QDX07_RS18755 | Protein ID | WP_001291435.1 |
Coordinates | 3786236..3786454 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QDX07_RS18750 | Protein ID | WP_000344800.1 |
Coordinates | 3785836..3786210 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX07_RS18740 (3780925) | 3780925..3782118 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QDX07_RS18745 (3782141) | 3782141..3785290 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
QDX07_RS18750 (3785836) | 3785836..3786210 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QDX07_RS18755 (3786236) | 3786236..3786454 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QDX07_RS18760 (3786626) | 3786626..3787177 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
QDX07_RS18765 (3787293) | 3787293..3787763 | + | 471 | WP_063085325.1 | YlaC family protein | - |
QDX07_RS18770 (3787927) | 3787927..3789477 | + | 1551 | WP_063085326.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QDX07_RS18775 (3789519) | 3789519..3789872 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QDX07_RS18785 (3790251) | 3790251..3790562 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QDX07_RS18790 (3790593) | 3790593..3791165 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T278275 WP_001291435.1 NZ_CP122938:3786236-3786454 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT278275 WP_000344800.1 NZ_CP122938:3785836-3786210 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |