Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3015286..3016120 | Replicon | chromosome |
| Accession | NZ_CP122938 | ||
| Organism | Escherichia coli strain ETEC1701 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A3S7R4W2 |
| Locus tag | QDX07_RS14925 | Protein ID | WP_063085447.1 |
| Coordinates | 3015286..3015663 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A2J4HRK6 |
| Locus tag | QDX07_RS14930 | Protein ID | WP_001354276.1 |
| Coordinates | 3015752..3016120 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX07_RS14885 (3010670) | 3010670..3011503 | + | 834 | WP_001189321.1 | curli production assembly/transport protein CsgG | - |
| QDX07_RS14890 (3011568) | 3011568..3012059 | - | 492 | WP_032140678.1 | DUF1097 domain-containing protein | - |
| QDX07_RS14895 (3012161) | 3012161..3012715 | - | 555 | WP_063085449.1 | molecular chaperone YcdY | - |
| QDX07_RS14900 (3012739) | 3012739..3013476 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| QDX07_RS14905 (3013531) | 3013531..3014469 | - | 939 | WP_001357083.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| QDX07_RS14915 (3014939) | 3014939..3015181 | - | 243 | WP_242378885.1 | DUF4942 domain-containing protein | - |
| QDX07_RS14920 (3015161) | 3015161..3015289 | - | 129 | Protein_2923 | DUF5983 family protein | - |
| QDX07_RS14925 (3015286) | 3015286..3015663 | - | 378 | WP_063085447.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QDX07_RS14930 (3015752) | 3015752..3016120 | - | 369 | WP_001354276.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QDX07_RS14935 (3016377) | 3016377..3016673 | - | 297 | Protein_2926 | antirestriction protein | - |
| QDX07_RS14940 (3016642) | 3016642..3017514 | - | 873 | Protein_2927 | AIDA repeat-containing protein | - |
| QDX07_RS14945 (3017886) | 3017886..3018758 | - | 873 | WP_001069760.1 | GTPase family protein | - |
| QDX07_RS14950 (3019022) | 3019022..3020578 | + | 1557 | WP_086186061.1 | type I restriction-modification system subunit M | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13908.94 Da Isoelectric Point: 8.5222
>T278273 WP_063085447.1 NZ_CP122938:c3015663-3015286 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNNTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNNTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13649.47 Da Isoelectric Point: 7.0261
>AT278273 WP_001354276.1 NZ_CP122938:c3016120-3015752 [Escherichia coli]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S7R4W2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4HRK6 |