Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2557253..2557891 | Replicon | chromosome |
Accession | NZ_CP122938 | ||
Organism | Escherichia coli strain ETEC1701 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A3A6S5Q3 |
Locus tag | QDX07_RS12495 | Protein ID | WP_063085535.1 |
Coordinates | 2557715..2557891 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QDX07_RS12490 | Protein ID | WP_001270286.1 |
Coordinates | 2557253..2557669 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX07_RS12470 (2552405) | 2552405..2553346 | - | 942 | WP_063085538.1 | ABC transporter permease | - |
QDX07_RS12475 (2553347) | 2553347..2554360 | - | 1014 | WP_063085537.1 | ABC transporter ATP-binding protein | - |
QDX07_RS12480 (2554378) | 2554378..2555523 | - | 1146 | WP_000047450.1 | ABC transporter substrate-binding protein | - |
QDX07_RS12485 (2555768) | 2555768..2557174 | - | 1407 | WP_063085536.1 | PLP-dependent aminotransferase family protein | - |
QDX07_RS12490 (2557253) | 2557253..2557669 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QDX07_RS12495 (2557715) | 2557715..2557891 | - | 177 | WP_063085535.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QDX07_RS12500 (2558113) | 2558113..2558343 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QDX07_RS12505 (2558435) | 2558435..2560396 | - | 1962 | WP_063085534.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QDX07_RS12510 (2560469) | 2560469..2561005 | - | 537 | WP_000429507.1 | DNA-binding transcriptional regulator SutR | - |
QDX07_RS12515 (2561097) | 2561097..2562267 | + | 1171 | Protein_2450 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6751.78 Da Isoelectric Point: 11.5666
>T278269 WP_063085535.1 NZ_CP122938:c2557891-2557715 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT278269 WP_001270286.1 NZ_CP122938:c2557669-2557253 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|