Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 23360..23907 Replicon plasmid unnamed3
Accession NZ_CP122932
Organism Escherichia coli strain ETEC1702

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag QDX05_RS24300 Protein ID WP_001384452.1
Coordinates 23629..23907 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag QDX05_RS24295 Protein ID WP_000079941.1
Coordinates 23360..23629 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX05_RS24280 (18660) 18660..19010 + 351 WP_000454193.1 DUF3330 domain-containing protein -
QDX05_RS24285 (19186) 19186..19746 + 561 WP_001161490.1 recombinase family protein -
QDX05_RS24290 (19750) 19750..22716 + 2967 WP_001138014.1 Tn3-like element TnAs1 family transposase -
QDX05_RS24295 (23360) 23360..23629 + 270 WP_000079941.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
QDX05_RS24300 (23629) 23629..23907 + 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
QDX05_RS24305 (23953) 23953..24801 + 849 WP_001057989.1 3'-5' exonuclease -
QDX05_RS24310 (24987) 24987..26867 + 1881 WP_001283335.1 colicin Ia central receptor-binding domain-containing protein -
QDX05_RS24315 (26889) 26889..27224 - 336 WP_001080729.1 colicin 1A immunity protein -
QDX05_RS24320 (27353) 27353..27568 + 216 Protein_31 DUF6404 family protein -
QDX05_RS24325 (27630) 27630..28220 - 591 WP_001518980.1 hypothetical protein -
QDX05_RS24330 (28217) 28217..28477 - 261 WP_000343091.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid qacE / ant(3'')-Ia / dfrA1 / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B / dfrA5 / sitABCD iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucB / iucC / iucD / iutA 1..152206 152206


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T278255 WP_001384452.1 NZ_CP122932:23629-23907 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT278255 WP_000079941.1 NZ_CP122932:23360-23629 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References