Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3512653..3513271 | Replicon | chromosome |
Accession | NZ_CP122929 | ||
Organism | Escherichia coli strain ETEC1702 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QDX05_RS17480 | Protein ID | WP_001291435.1 |
Coordinates | 3513053..3513271 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QDX05_RS17475 | Protein ID | WP_000344800.1 |
Coordinates | 3512653..3513027 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX05_RS17465 (3507742) | 3507742..3508935 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QDX05_RS17470 (3508958) | 3508958..3512107 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QDX05_RS17475 (3512653) | 3512653..3513027 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QDX05_RS17480 (3513053) | 3513053..3513271 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QDX05_RS17485 (3513443) | 3513443..3513994 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
QDX05_RS17490 (3514110) | 3514110..3514580 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QDX05_RS17495 (3514744) | 3514744..3516294 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QDX05_RS17500 (3516336) | 3516336..3516689 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QDX05_RS17510 (3517068) | 3517068..3517379 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QDX05_RS17515 (3517410) | 3517410..3517982 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T278247 WP_001291435.1 NZ_CP122929:3513053-3513271 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT278247 WP_000344800.1 NZ_CP122929:3512653-3513027 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |