Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2447612..2448250 | Replicon | chromosome |
Accession | NZ_CP122929 | ||
Organism | Escherichia coli strain ETEC1702 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
Locus tag | QDX05_RS12185 | Protein ID | WP_001447010.1 |
Coordinates | 2448074..2448250 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QDX05_RS12180 | Protein ID | WP_001270286.1 |
Coordinates | 2447612..2448028 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX05_RS12160 (2442765) | 2442765..2443706 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
QDX05_RS12165 (2443707) | 2443707..2444720 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
QDX05_RS12170 (2444738) | 2444738..2445883 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
QDX05_RS12175 (2446128) | 2446128..2447533 | - | 1406 | Protein_2383 | PLP-dependent aminotransferase family protein | - |
QDX05_RS12180 (2447612) | 2447612..2448028 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QDX05_RS12185 (2448074) | 2448074..2448250 | - | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QDX05_RS12190 (2448472) | 2448472..2448702 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QDX05_RS12195 (2448794) | 2448794..2450755 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QDX05_RS12200 (2450828) | 2450828..2451364 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
QDX05_RS12205 (2451456) | 2451456..2452631 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T278246 WP_001447010.1 NZ_CP122929:c2448250-2448074 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT278246 WP_001270286.1 NZ_CP122929:c2448028-2447612 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|