Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1840423..1841254 Replicon chromosome
Accession NZ_CP122929
Organism Escherichia coli strain ETEC1702

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QDX05_RS09005 Protein ID WP_000854814.1
Coordinates 1840423..1840797 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag QDX05_RS09010 Protein ID WP_001285585.1
Coordinates 1840886..1841254 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX05_RS08965 (1835819) 1835819..1836985 + 1167 WP_000830163.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
QDX05_RS08970 (1837104) 1837104..1837577 + 474 WP_001105393.1 DNA gyrase inhibitor SbmC -
QDX05_RS08975 (1837775) 1837775..1838833 + 1059 WP_001200905.1 FUSC family protein -
QDX05_RS08980 (1839005) 1839005..1839334 + 330 WP_000450409.1 DUF496 family protein -
QDX05_RS08985 (1839435) 1839435..1839659 - 225 WP_000917607.1 EutP/PduV family microcompartment system protein -
QDX05_RS08990 (1839671) 1839671..1839817 + 147 Protein_1757 transposase domain-containing protein -
QDX05_RS08995 (1840106) 1840106..1840186 - 81 Protein_1758 hypothetical protein -
QDX05_RS09000 (1840232) 1840232..1840426 - 195 WP_000988600.1 DUF5983 family protein -
QDX05_RS09005 (1840423) 1840423..1840797 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QDX05_RS09010 (1840886) 1840886..1841254 - 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QDX05_RS09015 (1841328) 1841328..1841549 - 222 WP_000692323.1 DUF987 domain-containing protein -
QDX05_RS09020 (1841612) 1841612..1842088 - 477 WP_001186773.1 RadC family protein -
QDX05_RS09025 (1842104) 1842104..1842583 - 480 WP_000860076.1 antirestriction protein -
QDX05_RS09030 (1842665) 1842665..1843486 - 822 WP_001234530.1 DUF932 domain-containing protein -
QDX05_RS09035 (1843707) 1843707..1844117 - 411 WP_000846713.1 hypothetical protein -
QDX05_RS09040 (1844133) 1844133..1844815 - 683 Protein_1767 hypothetical protein -
QDX05_RS09045 (1844951) 1844951..1846021 - 1071 WP_000102643.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T278239 WP_000854814.1 NZ_CP122929:c1840797-1840423 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT278239 WP_001285585.1 NZ_CP122929:c1841254-1840886 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References