Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 25364..25989 | Replicon | plasmid unnamed4 |
| Accession | NZ_CP122927 | ||
| Organism | Escherichia coli strain ETEC1703 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QDX14_RS27185 | Protein ID | WP_000911317.1 |
| Coordinates | 25364..25762 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | L4J1D2 |
| Locus tag | QDX14_RS27190 | Protein ID | WP_000450532.1 |
| Coordinates | 25762..25989 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX14_RS27155 (20564) | 20564..20734 | - | 171 | WP_227432179.1 | hypothetical protein | - |
| QDX14_RS27160 (21032) | 21032..21463 | - | 432 | Protein_27 | transposase | - |
| QDX14_RS27165 (21461) | 21461..22495 | + | 1035 | Protein_28 | conjugal transfer protein TraG | - |
| QDX14_RS27170 (22511) | 22511..23008 | + | 498 | WP_032084504.1 | entry exclusion protein | - |
| QDX14_RS27175 (23040) | 23040..23771 | + | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
| QDX14_RS27180 (24022) | 24022..25212 | + | 1191 | Protein_31 | type IV conjugative transfer system coupling protein TraD | - |
| QDX14_RS27185 (25364) | 25364..25762 | - | 399 | WP_000911317.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QDX14_RS27190 (25762) | 25762..25989 | - | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| QDX14_RS27195 (26071) | 26071..30305 | + | 4235 | Protein_34 | conjugative transfer relaxase/helicase TraI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | hlyD | 1..107634 | 107634 | |
| - | flank | IS/Tn | - | - | 21032..21475 | 443 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14857.14 Da Isoelectric Point: 8.5264
>T278228 WP_000911317.1 NZ_CP122927:c25762-25364 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|