Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 30056..30554 Replicon plasmid unnamed1
Accession NZ_CP122924
Organism Escherichia coli strain ETEC1703

Toxin (Protein)


Gene name TsxA Uniprot ID A0A764VNK7
Locus tag QDX14_RS26200 Protein ID WP_000868275.1
Coordinates 30288..30554 (-) Length 89 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID A0A3H7VMJ5
Locus tag QDX14_RS26195 Protein ID WP_001450803.1
Coordinates 30056..30298 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX14_RS26165 (QDX14_26165) 25599..26303 + 705 WP_001279864.1 hypothetical protein -
QDX14_RS26170 (QDX14_26170) 26332..26769 - 438 WP_000466317.1 type II toxin-antitoxin system HicB family antitoxin -
QDX14_RS26175 (QDX14_26175) 26794..26976 - 183 WP_000833471.1 type II toxin-antitoxin system HicA family toxin -
QDX14_RS26180 (QDX14_26180) 27172..27450 - 279 WP_000545935.1 cobalamin biosynthesis protein CbiX -
QDX14_RS26185 (QDX14_26185) 27880..28281 + 402 WP_000124097.1 hypothetical protein -
QDX14_RS26190 (QDX14_26190) 28244..29431 + 1188 WP_000937612.1 IS91-like element IS91 family transposase -
QDX14_RS26195 (QDX14_26195) 30056..30298 - 243 WP_001450803.1 hypothetical protein Antitoxin
QDX14_RS26200 (QDX14_26200) 30288..30554 - 267 WP_000868275.1 hypothetical protein Toxin
QDX14_RS26205 (QDX14_26205) 30605..30829 - 225 WP_000749827.1 hypothetical protein -
QDX14_RS26210 (QDX14_26210) 30925..31149 - 225 WP_000866040.1 hypothetical protein -
QDX14_RS26215 (QDX14_26215) 31234..32345 + 1112 Protein_30 IS4-like element IS421 family transposase -
QDX14_RS26220 (QDX14_26220) 32539..32862 - 324 WP_000432878.1 hypothetical protein -
QDX14_RS26225 (QDX14_26225) 33013..33138 - 126 WP_282863383.1 hypothetical protein -
QDX14_RS26230 (QDX14_26230) 33557..34744 + 1188 WP_000937612.1 IS91-like element IS91 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - hlyA / hlyB / hlyD / hlyC 1..69026 69026
- inside IScluster/Tn - - 28223..34744 6521


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10199.63 Da        Isoelectric Point: 9.5657

>T278221 WP_000868275.1 NZ_CP122924:c30554-30288 [Escherichia coli]
MKVRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVITVADLIFHEDAFDTIDFTRGGLRENDKEVVSMMIQEMN
NEREKNVN

Download         Length: 267 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9288.69 Da        Isoelectric Point: 9.7120

>AT278221 WP_001450803.1 NZ_CP122924:c30298-30056 [Escherichia coli]
MLTENTPENIKRLRQKIGLTQRECAEIFSMNPRTWRRKEEPAGTASGTALTPVEFKYLQLLAGEHPEYVLRKRDKPKCSE

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A764VNK7

Antitoxin

Source ID Structure
AlphaFold DB A0A3H7VMJ5

References