Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 26332..26976 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP122924 | ||
| Organism | Escherichia coli strain ETEC1703 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7L6LII1 |
| Locus tag | QDX14_RS26175 | Protein ID | WP_000833471.1 |
| Coordinates | 26794..26976 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A7L6LHN8 |
| Locus tag | QDX14_RS26170 | Protein ID | WP_000466317.1 |
| Coordinates | 26332..26769 (-) | Length | 146 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX14_RS26150 (QDX14_26150) | 23755..24090 | - | 336 | WP_000963832.1 | DUF6290 family protein | - |
| QDX14_RS26155 (QDX14_26155) | 24424..24831 | + | 408 | WP_001190622.1 | hypothetical protein | - |
| QDX14_RS26160 (QDX14_26160) | 24841..25602 | + | 762 | WP_001097938.1 | conjugal transfer protein TraL | - |
| QDX14_RS26165 (QDX14_26165) | 25599..26303 | + | 705 | WP_001279864.1 | hypothetical protein | - |
| QDX14_RS26170 (QDX14_26170) | 26332..26769 | - | 438 | WP_000466317.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QDX14_RS26175 (QDX14_26175) | 26794..26976 | - | 183 | WP_000833471.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QDX14_RS26180 (QDX14_26180) | 27172..27450 | - | 279 | WP_000545935.1 | cobalamin biosynthesis protein CbiX | - |
| QDX14_RS26185 (QDX14_26185) | 27880..28281 | + | 402 | WP_000124097.1 | hypothetical protein | - |
| QDX14_RS26190 (QDX14_26190) | 28244..29431 | + | 1188 | WP_000937612.1 | IS91-like element IS91 family transposase | - |
| QDX14_RS26195 (QDX14_26195) | 30056..30298 | - | 243 | WP_001450803.1 | hypothetical protein | - |
| QDX14_RS26200 (QDX14_26200) | 30288..30554 | - | 267 | WP_000868275.1 | hypothetical protein | - |
| QDX14_RS26205 (QDX14_26205) | 30605..30829 | - | 225 | WP_000749827.1 | hypothetical protein | - |
| QDX14_RS26210 (QDX14_26210) | 30925..31149 | - | 225 | WP_000866040.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | hlyA / hlyB / hlyD / hlyC | 1..69026 | 69026 | |
| - | inside | IScluster/Tn | - | - | 28223..34744 | 6521 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6675.97 Da Isoelectric Point: 11.0013
>T278220 WP_000833471.1 NZ_CP122924:c26976-26794 [Escherichia coli]
MKSADLLKELIAAGCELKRHKASSHQIWWSPITGKTFPVPHPKKDLPLGTVRSIRKMAGI
MKSADLLKELIAAGCELKRHKASSHQIWWSPITGKTFPVPHPKKDLPLGTVRSIRKMAGI
Download Length: 183 bp
Antitoxin
Download Length: 146 a.a. Molecular weight: 16227.10 Da Isoelectric Point: 4.3135
>AT278220 WP_000466317.1 NZ_CP122924:c26769-26332 [Escherichia coli]
MFFSVGVETPKDDHTAYGITVPAFDRFDFGCVSAADTQSEIPVMAREAILAIVEEMVLSGSYSVDDIHDDGCLTYAANQD
YSHCDSWFVIDVDLSEIEGKQQRINIALPDVLIRRIDGFVRESGGVYRDRSHFLAQAARHELSYK
MFFSVGVETPKDDHTAYGITVPAFDRFDFGCVSAADTQSEIPVMAREAILAIVEEMVLSGSYSVDDIHDDGCLTYAANQD
YSHCDSWFVIDVDLSEIEGKQQRINIALPDVLIRRIDGFVRESGGVYRDRSHFLAQAARHELSYK
Download Length: 438 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7L6LII1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7L6LHN8 |