Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2595682..2596320 | Replicon | chromosome |
| Accession | NZ_CP122923 | ||
| Organism | Escherichia coli strain ETEC1703 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | QDX14_RS12775 | Protein ID | WP_000813794.1 |
| Coordinates | 2596144..2596320 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QDX14_RS12770 | Protein ID | WP_141227792.1 |
| Coordinates | 2595682..2596098 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX14_RS12750 (2590834) | 2590834..2591775 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
| QDX14_RS12755 (2591776) | 2591776..2592789 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| QDX14_RS12760 (2592807) | 2592807..2593952 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| QDX14_RS12765 (2594197) | 2594197..2595603 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| QDX14_RS12770 (2595682) | 2595682..2596098 | - | 417 | WP_141227792.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| QDX14_RS12775 (2596144) | 2596144..2596320 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| QDX14_RS12780 (2596542) | 2596542..2596772 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| QDX14_RS12785 (2596864) | 2596864..2598825 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| QDX14_RS12790 (2598898) | 2598898..2599434 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| QDX14_RS12795 (2599526) | 2599526..2600701 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2595682..2646722 | 51040 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T278216 WP_000813794.1 NZ_CP122923:c2596320-2596144 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15216.60 Da Isoelectric Point: 4.7386
>AT278216 WP_141227792.1 NZ_CP122923:c2596098-2595682 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEIARLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEIARLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|