Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 2077051..2077529 Replicon chromosome
Accession NZ_CP122923
Organism Escherichia coli strain ETEC1703

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A7D8WGY6
Locus tag QDX14_RS10080 Protein ID WP_000936798.1
Coordinates 2077051..2077338 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID -
Locus tag QDX14_RS10085 Protein ID WP_097330581.1
Coordinates 2077338..2077529 (-) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX14_RS10050 (2072064) 2072064..2075201 - 3138 WP_282863206.1 PD-(D/E)XK nuclease-like domain-containing protein -
QDX14_RS10055 (2075282) 2075282..2075485 - 204 WP_053289477.1 DUF1482 family protein -
QDX14_RS10060 (2075482) 2075482..2075670 - 189 WP_089565158.1 cell division inhibition protein DicB -
QDX14_RS10065 (2076241) 2076241..2076459 - 219 WP_001171946.1 protein YdfC -
QDX14_RS10070 (2076489) 2076489..2076617 - 129 WP_000344974.1 protein YdfB -
QDX14_RS10075 (2076619) 2076619..2076774 - 156 WP_000379575.1 DUF1391 family protein -
QDX14_RS10080 (2077051) 2077051..2077338 - 288 WP_000936798.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDX14_RS10085 (2077338) 2077338..2077529 - 192 WP_097330581.1 antitoxin Antitoxin
QDX14_RS10090 (2077557) 2077557..2077958 - 402 WP_001329851.1 helix-turn-helix domain-containing protein -
QDX14_RS10095 (2078068) 2078068..2078340 + 273 WP_097330580.1 YdaS family helix-turn-helix protein -
QDX14_RS10100 (2078324) 2078324..2078749 + 426 WP_000693850.1 toxin YdaT family protein -
QDX14_RS10105 (2078821) 2078821..2079891 + 1071 WP_282863213.1 phage replisome organizer -
QDX14_RS10110 (2079898) 2079898..2080644 + 747 WP_137689916.1 ATP-binding protein -
QDX14_RS10115 (2080667) 2080667..2081428 + 762 WP_000450665.1 DUF1627 domain-containing protein -
QDX14_RS10120 (2081444) 2081444..2081866 + 423 WP_282863216.1 DUF977 family protein -
QDX14_RS10125 (2081924) 2081924..2082280 + 357 WP_040072812.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2063226..2134919 71693


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10899.83 Da        Isoelectric Point: 10.1360

>T278215 WP_000936798.1 NZ_CP122923:c2077338-2077051 [Escherichia coli]
MLPILWLPSARDDLRQIVAYIAKENIPAARRLKIRIETSVLALSEHPYLYPPSDRVSGLREIVVHPNYIVLYRVAASSIE
IANIVHARRQFPFPI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7065.83 Da        Isoelectric Point: 4.0270

>AT278215 WP_097330581.1 NZ_CP122923:c2077529-2077338 [Escherichia coli]
MSTALSPIVSEFETTEQENSYNEWLRAKVTSSLADPRPSIPHDEVMAEMENLIAQIAVTNRSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7D8WGY6

Antitoxin

Source ID Structure

References