Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | paaR-paaA-parE/- |
| Location | 2077051..2077529 | Replicon | chromosome |
| Accession | NZ_CP122923 | ||
| Organism | Escherichia coli strain ETEC1703 | ||
Toxin (Protein)
| Gene name | parE_1 | Uniprot ID | A0A7D8WGY6 |
| Locus tag | QDX14_RS10080 | Protein ID | WP_000936798.1 |
| Coordinates | 2077051..2077338 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | paaA | Uniprot ID | - |
| Locus tag | QDX14_RS10085 | Protein ID | WP_097330581.1 |
| Coordinates | 2077338..2077529 (-) | Length | 64 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX14_RS10050 (2072064) | 2072064..2075201 | - | 3138 | WP_282863206.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| QDX14_RS10055 (2075282) | 2075282..2075485 | - | 204 | WP_053289477.1 | DUF1482 family protein | - |
| QDX14_RS10060 (2075482) | 2075482..2075670 | - | 189 | WP_089565158.1 | cell division inhibition protein DicB | - |
| QDX14_RS10065 (2076241) | 2076241..2076459 | - | 219 | WP_001171946.1 | protein YdfC | - |
| QDX14_RS10070 (2076489) | 2076489..2076617 | - | 129 | WP_000344974.1 | protein YdfB | - |
| QDX14_RS10075 (2076619) | 2076619..2076774 | - | 156 | WP_000379575.1 | DUF1391 family protein | - |
| QDX14_RS10080 (2077051) | 2077051..2077338 | - | 288 | WP_000936798.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QDX14_RS10085 (2077338) | 2077338..2077529 | - | 192 | WP_097330581.1 | antitoxin | Antitoxin |
| QDX14_RS10090 (2077557) | 2077557..2077958 | - | 402 | WP_001329851.1 | helix-turn-helix domain-containing protein | - |
| QDX14_RS10095 (2078068) | 2078068..2078340 | + | 273 | WP_097330580.1 | YdaS family helix-turn-helix protein | - |
| QDX14_RS10100 (2078324) | 2078324..2078749 | + | 426 | WP_000693850.1 | toxin YdaT family protein | - |
| QDX14_RS10105 (2078821) | 2078821..2079891 | + | 1071 | WP_282863213.1 | phage replisome organizer | - |
| QDX14_RS10110 (2079898) | 2079898..2080644 | + | 747 | WP_137689916.1 | ATP-binding protein | - |
| QDX14_RS10115 (2080667) | 2080667..2081428 | + | 762 | WP_000450665.1 | DUF1627 domain-containing protein | - |
| QDX14_RS10120 (2081444) | 2081444..2081866 | + | 423 | WP_282863216.1 | DUF977 family protein | - |
| QDX14_RS10125 (2081924) | 2081924..2082280 | + | 357 | WP_040072812.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2063226..2134919 | 71693 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10899.83 Da Isoelectric Point: 10.1360
>T278215 WP_000936798.1 NZ_CP122923:c2077338-2077051 [Escherichia coli]
MLPILWLPSARDDLRQIVAYIAKENIPAARRLKIRIETSVLALSEHPYLYPPSDRVSGLREIVVHPNYIVLYRVAASSIE
IANIVHARRQFPFPI
MLPILWLPSARDDLRQIVAYIAKENIPAARRLKIRIETSVLALSEHPYLYPPSDRVSGLREIVVHPNYIVLYRVAASSIE
IANIVHARRQFPFPI
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|