Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 939483..940137 | Replicon | chromosome |
Accession | NZ_CP122923 | ||
Organism | Escherichia coli strain ETEC1703 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | QDX14_RS04585 | Protein ID | WP_000244777.1 |
Coordinates | 939730..940137 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QDX14_RS04580 | Protein ID | WP_000354046.1 |
Coordinates | 939483..939749 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX14_RS04560 (935452) | 935452..936885 | - | 1434 | WP_001514525.1 | 6-phospho-beta-glucosidase BglA | - |
QDX14_RS04565 (936930) | 936930..937241 | + | 312 | WP_001514524.1 | N(4)-acetylcytidine aminohydrolase | - |
QDX14_RS04570 (937405) | 937405..938064 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
QDX14_RS04575 (938260) | 938260..939240 | - | 981 | WP_001514522.1 | tRNA-modifying protein YgfZ | - |
QDX14_RS04580 (939483) | 939483..939749 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QDX14_RS04585 (939730) | 939730..940137 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
QDX14_RS04590 (940177) | 940177..940698 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QDX14_RS04595 (940810) | 940810..941706 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QDX14_RS04600 (941731) | 941731..942441 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QDX14_RS04605 (942447) | 942447..944180 | + | 1734 | WP_032187585.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T278206 WP_000244777.1 NZ_CP122923:939730-940137 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |