Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 841652..842487 | Replicon | chromosome |
| Accession | NZ_CP122923 | ||
| Organism | Escherichia coli strain ETEC1703 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A3A6S2N5 |
| Locus tag | QDX14_RS04040 | Protein ID | WP_000854800.1 |
| Coordinates | 841652..842029 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A3Z2YIX3 |
| Locus tag | QDX14_RS04045 | Protein ID | WP_032178229.1 |
| Coordinates | 842119..842487 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX14_RS04010 (837059) | 837059..838036 | + | 978 | WP_000633209.1 | type II secretion system minor pseudopilin GspK | - |
| QDX14_RS04015 (838033) | 838033..839211 | + | 1179 | WP_282863148.1 | type II secretion system protein GspL | - |
| QDX14_RS04020 (839213) | 839213..839749 | + | 537 | WP_000942785.1 | GspM family type II secretion system protein YghD | - |
| QDX14_RS04025 (840031) | 840031..840873 | - | 843 | WP_063086391.1 | DUF4942 domain-containing protein | - |
| QDX14_RS04030 (840958) | 840958..841155 | - | 198 | WP_001374283.1 | DUF957 domain-containing protein | - |
| QDX14_RS04035 (841167) | 841167..841655 | - | 489 | WP_000779171.1 | DUF5983 family protein | - |
| QDX14_RS04040 (841652) | 841652..842029 | - | 378 | WP_000854800.1 | TA system toxin CbtA family protein | Toxin |
| QDX14_RS04045 (842119) | 842119..842487 | - | 369 | WP_032178229.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDX14_RS04050 (842537) | 842537..843181 | - | 645 | WP_000086748.1 | hypothetical protein | - |
| QDX14_RS04055 (843200) | 843200..843421 | - | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
| QDX14_RS04060 (843490) | 843490..843966 | - | 477 | WP_001186784.1 | RadC family protein | - |
| QDX14_RS04065 (843981) | 843981..844466 | - | 486 | WP_000213706.1 | antirestriction protein | - |
| QDX14_RS04070 (844558) | 844558..845376 | - | 819 | WP_001234392.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14068.13 Da Isoelectric Point: 9.1376
>T278205 WP_000854800.1 NZ_CP122923:c842029-841652 [Escherichia coli]
MKTLPVLPGQAAGLRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDKPGF
NACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHSEAKR
MKTLPVLPGQAAGLRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDKPGF
NACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHSEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13823.58 Da Isoelectric Point: 6.3177
>AT278205 WP_032178229.1 NZ_CP122923:c842487-842119 [Escherichia coli]
VSDTLHETNYPDDNNDRSWWGLPCTVTPCFRARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLHETNYPDDNNDRSWWGLPCTVTPCFRARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3A6S2N5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z2YIX3 |