Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 60100..60659 Replicon plasmid unnamed4
Accession NZ_CP122884
Organism Escherichia coli strain ETEC1716

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag QDX09_RS26765 Protein ID WP_000421257.1
Coordinates 60100..60375 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag QDX09_RS26770 Protein ID WP_001178089.1
Coordinates 60375..60659 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX09_RS26735 (55240) 55240..55662 - 423 WP_001398192.1 hypothetical protein -
QDX09_RS26740 (55834) 55834..56097 - 264 WP_000063165.1 hypothetical protein -
QDX09_RS26745 (56236) 56236..57648 - 1413 Protein_60 DNA topoisomerase -
QDX09_RS26750 (57730) 57730..58095 + 366 WP_000124098.1 hypothetical protein -
QDX09_RS26755 (58095) 58095..59282 + 1188 WP_000937614.1 IS91-like element IS91 family transposase -
QDX09_RS26760 (59458) 59458..59817 + 360 Protein_63 transposase -
QDX09_RS26765 (60100) 60100..60375 - 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDX09_RS26770 (60375) 60375..60659 - 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
QDX09_RS26775 (61569) 61569..62426 - 858 WP_024233440.1 incFII family plasmid replication initiator RepA -
QDX09_RS26780 (62419) 62419..62493 - 75 WP_001365705.1 RepA leader peptide Tap -
QDX09_RS26785 (62730) 62730..62984 - 255 WP_000083830.1 replication regulatory protein RepA -
QDX09_RS26790 (63249) 63249..63581 - 333 WP_152916585.1 hypothetical protein -
QDX09_RS26795 (63643) 63643..64242 - 600 WP_063082122.1 PIN domain-containing protein -
QDX09_RS26800 (64629) 64629..64829 - 201 WP_015059022.1 hypothetical protein -
QDX09_RS26805 (64961) 64961..65521 - 561 WP_000139328.1 fertility inhibition protein FinO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - estIa / hlyC / hlyA / hlyB / hlyB / hlyD 1..123715 123715


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T278200 WP_000421257.1 NZ_CP122884:c60375-60100 [Escherichia coli]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10456.86 Da        Isoelectric Point: 5.6558

>AT278200 WP_001178089.1 NZ_CP122884:c60659-60375 [Escherichia coli]
IQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References