Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 17998..18599 | Replicon | plasmid unnamed2 |
Accession | NZ_CP122882 | ||
Organism | Escherichia coli strain ETEC1716 |
Toxin (Protein)
Gene name | doc | Uniprot ID | U9YA20 |
Locus tag | QDX09_RS25810 | Protein ID | WP_001216045.1 |
Coordinates | 17998..18378 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | QDX09_RS25815 | Protein ID | WP_001190712.1 |
Coordinates | 18378..18599 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX09_RS25785 (QDX09_25785) | 13439..14923 | - | 1485 | WP_000124150.1 | terminase | - |
QDX09_RS25790 (QDX09_25790) | 14923..16116 | - | 1194 | WP_032153803.1 | hypothetical protein | - |
QDX09_RS25795 (QDX09_25795) | 16202..16654 | - | 453 | WP_001326849.1 | late promoter-activating protein | - |
QDX09_RS25800 (QDX09_25800) | 16743..17786 | - | 1044 | WP_148116453.1 | DUF968 domain-containing protein | - |
QDX09_RS25805 (QDX09_25805) | 17814..17993 | - | 180 | WP_001436571.1 | hypothetical protein | - |
QDX09_RS25810 (QDX09_25810) | 17998..18378 | - | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
QDX09_RS25815 (QDX09_25815) | 18378..18599 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QDX09_RS25820 (QDX09_25820) | 18782..20338 | + | 1557 | WP_282862717.1 | type I restriction-modification system subunit M | - |
QDX09_RS25825 (QDX09_25825) | 20335..21555 | + | 1221 | WP_282862718.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..93572 | 93572 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T278198 WP_001216045.1 NZ_CP122882:c18378-17998 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CLP7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |