Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3252919..3253753 | Replicon | chromosome |
| Accession | NZ_CP122880 | ||
| Organism | Escherichia coli strain ETEC1716 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | W0S379 |
| Locus tag | QDX09_RS16235 | Protein ID | WP_000854808.1 |
| Coordinates | 3252919..3253296 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | W0S4A5 |
| Locus tag | QDX09_RS16240 | Protein ID | WP_001285114.1 |
| Coordinates | 3253385..3253753 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX09_RS16205 (3249600) | 3249600..3250304 | + | 705 | WP_001241678.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
| QDX09_RS16210 (3250589) | 3250589..3250807 | + | 219 | WP_001040187.1 | translation initiation factor IF-1 | - |
| QDX09_RS16220 (3251298) | 3251298..3252140 | - | 843 | WP_001280436.1 | DUF4942 domain-containing protein | - |
| QDX09_RS16225 (3252225) | 3252225..3252422 | - | 198 | WP_000839248.1 | DUF957 domain-containing protein | - |
| QDX09_RS16230 (3252434) | 3252434..3252922 | - | 489 | WP_000761657.1 | DUF5983 family protein | - |
| QDX09_RS16235 (3252919) | 3252919..3253296 | - | 378 | WP_000854808.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QDX09_RS16240 (3253385) | 3253385..3253753 | - | 369 | WP_001285114.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDX09_RS16245 (3253803) | 3253803..3254450 | - | 648 | WP_000094919.1 | hypothetical protein | - |
| QDX09_RS16250 (3254469) | 3254469..3254690 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QDX09_RS16255 (3254759) | 3254759..3255235 | - | 477 | WP_001186747.1 | RadC family protein | - |
| QDX09_RS16260 (3255251) | 3255251..3255736 | - | 486 | WP_000214416.1 | antirestriction protein | - |
| QDX09_RS16265 (3255828) | 3255828..3256646 | - | 819 | WP_001234743.1 | DUF932 domain-containing protein | - |
| QDX09_RS16270 (3256739) | 3256739..3256917 | + | 179 | Protein_3189 | hypothetical protein | - |
| QDX09_RS16275 (3257057) | 3257057..3257470 | - | 414 | WP_000789535.1 | hypothetical protein | - |
| QDX09_RS16280 (3257740) | 3257740..3258279 | - | 540 | WP_001104020.1 | DUF4339 domain-containing protein | - |
| QDX09_RS16285 (3258404) | 3258404..3258577 | - | 174 | WP_001370911.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13909.93 Da Isoelectric Point: 7.9085
>T278189 WP_000854808.1 NZ_CP122880:c3253296-3252919 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13767.60 Da Isoelectric Point: 6.9460
>AT278189 WP_001285114.1 NZ_CP122880:c3253753-3253385 [Escherichia coli]
VSDSLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQALPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN
VSDSLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQALPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|