Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2655239..2655877 | Replicon | chromosome |
Accession | NZ_CP122880 | ||
Organism | Escherichia coli strain ETEC1716 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QDX09_RS13235 | Protein ID | WP_000813794.1 |
Coordinates | 2655701..2655877 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QDX09_RS13230 | Protein ID | WP_001270286.1 |
Coordinates | 2655239..2655655 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX09_RS13210 (2650391) | 2650391..2651332 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
QDX09_RS13215 (2651333) | 2651333..2652346 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
QDX09_RS13220 (2652364) | 2652364..2653509 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
QDX09_RS13225 (2653754) | 2653754..2655160 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
QDX09_RS13230 (2655239) | 2655239..2655655 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QDX09_RS13235 (2655701) | 2655701..2655877 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QDX09_RS13240 (2656099) | 2656099..2656329 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QDX09_RS13245 (2656421) | 2656421..2658382 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QDX09_RS13250 (2658455) | 2658455..2658991 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
QDX09_RS13255 (2659083) | 2659083..2660258 | + | 1176 | WP_282862205.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T278188 WP_000813794.1 NZ_CP122880:c2655877-2655701 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT278188 WP_001270286.1 NZ_CP122880:c2655655-2655239 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|