Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 823604..824439 | Replicon | chromosome |
| Accession | NZ_CP122880 | ||
| Organism | Escherichia coli strain ETEC1716 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A7W3AJH4 |
| Locus tag | QDX09_RS04060 | Protein ID | WP_000854721.1 |
| Coordinates | 823604..823981 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QDX09_RS04065 | Protein ID | WP_003986733.1 |
| Coordinates | 824071..824439 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX09_RS04030 (819575) | 819575..820837 | - | 1263 | WP_001218865.1 | integrase arm-type DNA-binding domain-containing protein | - |
| QDX09_RS04035 (821301) | 821301..821627 | - | 327 | WP_000779482.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QDX09_RS04040 (821624) | 821624..821887 | - | 264 | WP_001143297.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| QDX09_RS04045 (821959) | 821959..822825 | - | 867 | WP_024257423.1 | DUF4942 domain-containing protein | - |
| QDX09_RS04050 (822910) | 822910..823107 | - | 198 | WP_000839240.1 | DUF957 domain-containing protein | - |
| QDX09_RS04055 (823119) | 823119..823607 | - | 489 | WP_000761678.1 | DUF5983 family protein | - |
| QDX09_RS04060 (823604) | 823604..823981 | - | 378 | WP_000854721.1 | TA system toxin CbtA family protein | Toxin |
| QDX09_RS04065 (824071) | 824071..824439 | - | 369 | WP_003986733.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDX09_RS04070 (824518) | 824518..824739 | - | 222 | WP_000692293.1 | DUF987 domain-containing protein | - |
| QDX09_RS04075 (824808) | 824808..825284 | - | 477 | WP_126511416.1 | RadC family protein | - |
| QDX09_RS04080 (825300) | 825300..825785 | - | 486 | WP_059342224.1 | antirestriction protein | - |
| QDX09_RS04085 (825877) | 825877..826695 | - | 819 | WP_023181002.1 | DUF932 domain-containing protein | - |
| QDX09_RS04090 (826786) | 826786..827007 | - | 222 | WP_024144968.1 | DUF905 family protein | - |
| QDX09_RS04095 (827083) | 827083..827619 | - | 537 | WP_001000101.1 | DUF4234 domain-containing protein | - |
| QDX09_RS04100 (827682) | 827682..828983 | - | 1302 | WP_282862409.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 801900..838003 | 36103 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14089.12 Da Isoelectric Point: 8.2904
>T278178 WP_000854721.1 NZ_CP122880:c823981-823604 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13600.35 Da Isoelectric Point: 6.3159
>AT278178 WP_003986733.1 NZ_CP122880:c824439-824071 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTSCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTHPDDNNDRPWWGLPCTVTSCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|