Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 800985..801820 | Replicon | chromosome |
| Accession | NZ_CP122880 | ||
| Organism | Escherichia coli strain ETEC1716 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A7W4PV54 |
| Locus tag | QDX09_RS03930 | Protein ID | WP_000854821.1 |
| Coordinates | 800985..801362 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MK11 |
| Locus tag | QDX09_RS03935 | Protein ID | WP_001285610.1 |
| Coordinates | 801452..801820 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX09_RS03895 (796065) | 796065..796664 | + | 600 | WP_001255034.1 | type II secretion system minor pseudopilin GspJ | - |
| QDX09_RS03900 (796667) | 796667..797644 | + | 978 | WP_000633209.1 | type II secretion system minor pseudopilin GspK | - |
| QDX09_RS03905 (797641) | 797641..798819 | + | 1179 | WP_000094991.1 | type II secretion system protein GspL | - |
| QDX09_RS03910 (798821) | 798821..799357 | + | 537 | WP_000942785.1 | GspM family type II secretion system protein YghD | - |
| QDX09_RS03915 (799639) | 799639..800481 | - | 843 | WP_001280493.1 | DUF4942 domain-containing protein | - |
| QDX09_RS03920 (800566) | 800566..800763 | - | 198 | WP_085949090.1 | DUF957 domain-containing protein | - |
| QDX09_RS03925 (800791) | 800791..800988 | - | 198 | Protein_771 | DUF5983 family protein | - |
| QDX09_RS03930 (800985) | 800985..801362 | - | 378 | WP_000854821.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QDX09_RS03935 (801452) | 801452..801820 | - | 369 | WP_001285610.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDX09_RS03940 (801900) | 801900..802121 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| QDX09_RS03945 (802208) | 802208..802684 | - | 477 | WP_001384108.1 | RadC family protein | - |
| QDX09_RS03950 (802700) | 802700..803182 | - | 483 | WP_000206657.1 | antirestriction protein | - |
| QDX09_RS03955 (803274) | 803274..804092 | - | 819 | WP_096937688.1 | DUF932 domain-containing protein | - |
| QDX09_RS03960 (804182) | 804182..804415 | - | 234 | WP_001117568.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13930.95 Da Isoelectric Point: 8.5163
>T278177 WP_000854821.1 NZ_CP122880:c801362-800985 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13606.39 Da Isoelectric Point: 6.0618
>AT278177 WP_001285610.1 NZ_CP122880:c801820-801452 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|