Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 800985..801820 Replicon chromosome
Accession NZ_CP122880
Organism Escherichia coli strain ETEC1716

Toxin (Protein)


Gene name yeeV Uniprot ID A0A7W4PV54
Locus tag QDX09_RS03930 Protein ID WP_000854821.1
Coordinates 800985..801362 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MK11
Locus tag QDX09_RS03935 Protein ID WP_001285610.1
Coordinates 801452..801820 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX09_RS03895 (796065) 796065..796664 + 600 WP_001255034.1 type II secretion system minor pseudopilin GspJ -
QDX09_RS03900 (796667) 796667..797644 + 978 WP_000633209.1 type II secretion system minor pseudopilin GspK -
QDX09_RS03905 (797641) 797641..798819 + 1179 WP_000094991.1 type II secretion system protein GspL -
QDX09_RS03910 (798821) 798821..799357 + 537 WP_000942785.1 GspM family type II secretion system protein YghD -
QDX09_RS03915 (799639) 799639..800481 - 843 WP_001280493.1 DUF4942 domain-containing protein -
QDX09_RS03920 (800566) 800566..800763 - 198 WP_085949090.1 DUF957 domain-containing protein -
QDX09_RS03925 (800791) 800791..800988 - 198 Protein_771 DUF5983 family protein -
QDX09_RS03930 (800985) 800985..801362 - 378 WP_000854821.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QDX09_RS03935 (801452) 801452..801820 - 369 WP_001285610.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QDX09_RS03940 (801900) 801900..802121 - 222 WP_000692350.1 DUF987 domain-containing protein -
QDX09_RS03945 (802208) 802208..802684 - 477 WP_001384108.1 RadC family protein -
QDX09_RS03950 (802700) 802700..803182 - 483 WP_000206657.1 antirestriction protein -
QDX09_RS03955 (803274) 803274..804092 - 819 WP_096937688.1 DUF932 domain-containing protein -
QDX09_RS03960 (804182) 804182..804415 - 234 WP_001117568.1 DUF905 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13930.95 Da        Isoelectric Point: 8.5163

>T278177 WP_000854821.1 NZ_CP122880:c801362-800985 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13606.39 Da        Isoelectric Point: 6.0618

>AT278177 WP_001285610.1 NZ_CP122880:c801820-801452 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W4PV54

Antitoxin

Source ID Structure

References